KEGG   Picrophilus torridus: PTO0068Help
Entry
PTO0068           CDS       T00177                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pto  Picrophilus torridus
Pathway
pto00500  Starch and sucrose metabolism
pto01100  Metabolic pathways
pto01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PTO0068
Enzymes [BR:pto01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PTO0068
Exosome [BR:pto04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PTO0068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3416 Alpha-amylase Malt_amylase_C hDGE_amylase Cyc-maltodext_C GHL6 Alpha-amylase_C
Motif
Other DBs
NCBI-ProteinID: AAT42653
UniProt: Q6L2Z8
Position
75032..76924
Genome map
AA seq 630 aa AA seqDB search
MDPVAIENVTPEIECGRFPAKIVVNSKFTVTAEVFRAGHDLVYPVLMYRKLKKRWRSVAM
KGTGNDLYEASFTPDEPGIYEYKISAWKDSYGTLIRNINAWLGSNEDVEQDLIEAINLIK
DAYKRSSGNDKKIIKRYLDDLINSDLNKKVMILNDNNFSSIIKKYQKKIDKTDYRTLRLI
ADPEYGGYGSWYELFPRSIGNFNDIIKHLNYVKSMNFNVLYLTPIHPIGITNRRGKNGSR
ISDKNDPGSPWAIGNDSGGHYSINSDLGSLEDFKNLLRSAREKNIMIAMDIALQCSPDHP
YVRDHPEWFYHRPDGSIRYAENPPKKYYDIYPLNFETKNKMALWNEMKNIFLYWISNGVK
IFRVDNPHTKPLDFWEWLINDIKRDHPDVVFLSEAFTRENLMFELSKRGFTMSYTYFTWK
LTKGEITEYFKKLYSYPYNFFFRPMLFTNTPDILGRDLSMGRNEFIIRSVLASTLSSLWG
IYSGFELCENDRLDDTEEYLNSEKYEIKRRNFNSDNNIKDIIARLNSIRDEMPALRSGKI
KFCETDNDKIIAYARYNNENKILVVLNLDTMNVQSGFIRVPLNDFSMDLNSIYDVHDVLN
NNHYKWSGEYNYVRLIPGKRQAHIMVIKNA
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggatccagtggcaattgagaatgtaacaccggagatagaatgcggaaggtttccggca
aagatagttgtaaacagcaaatttacggtgaccgcagaggttttcagggcaggtcacgac
cttgtttatcccgttttaatgtacaggaaattaaagaaaagatggagatcagttgccatg
aaaggcaccggcaatgatctttatgaggcatcatttacaccagatgagccgggaatatac
gaatacaaaatatcggcctggaaggattcatacggcactttaataaggaacataaatgcc
tggcttggctcaaacgaggatgttgaacaggatctaatcgaggcaatcaatttaattaaa
gatgcatataaaagatcctcaggaaatgataaaaaaattattaaaagataccttgatgat
ttaattaattcagatttaaataaaaaggtcatgatactaaatgataataatttctcatct
ataataaaaaaataccagaaaaaaatagataaaacggattacagaaccttaaggctcatc
gctgacccggaatacggcggctatggttcatggtacgagctttttccaagatccattggt
aactttaatgatataataaagcatttaaactatgtaaaatcgatgaatttcaatgtttta
tatttaacgccaatacatccaattggcattacaaacaggcgcgggaagaatggatcaaga
atttcagataaaaatgatccaggaagtccatgggccataggcaacgattccggggggcat
tactcgattaacagcgaccttggcagccttgaggacttcaagaatcttttaaggtctgcc
agggaaaaaaacatcatgatagccatggatattgctctgcagtgctcccctgatcatcca
tatgtaagggatcatcctgaatggttttatcacaggcctgacggctcaataagatacgct
gagaatccgccaaaaaaatactatgatatatatccattgaactttgaaacaaaaaacaaa
atggcattatggaacgagatgaagaacatatttttatactggatttcaaatggtgtaaaa
atattcagggtagataatccacatacaaagcccctggacttctgggagtggcttataaat
gatataaaaagggatcatccggatgttgtgtttttatccgaggcctttacaagggaaaat
cttatgtttgaactttcaaagcggggctttacaatgtcatatacatattttacatggaaa
ttaacaaagggcgagataacagagtatttcaaaaagctttattcatatccatataatttc
ttcttcaggccgatgcttttcacaaacacaccggatatacttggaagagatctttccatg
gggagaaatgaatttataataaggtccgtgcttgcctcaacgctttcatccctgtgggga
atatactcaggatttgaactatgcgagaatgaccgccttgatgatacagaggaatattta
aactctgagaagtacgaaataaaaaggagaaattttaatagcgataataatataaaagat
atcatagcaaggttaaactcaataagagatgagatgccggcgcttagatctggaaaaata
aaattctgcgaaacggacaatgataagataatagcatatgcaaggtataacaatgaaaac
aaaattcttgtcgttttaaaccttgatacaatgaatgttcaatcaggttttataagggtt
ccattgaatgatttttcaatggatttaaattccatatacgatgtccatgatgttttaaat
aacaatcattacaaatggagtggtgagtacaattatgtcaggttaatacccgggaagcgc
caggcgcatataatggtgattaaaaatgcttga

DBGET integrated database retrieval system