KEGG   Picrophilus torridus: PTO0068Help
Entry
PTO0068           CDS       T00177                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pto  Picrophilus torridus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PTO0068
Enzymes [BR:pto01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PTO0068
Exosome [BR:pto04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PTO0068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
75032..76924
Genome map
AA seq 630 aa AA seqDB search
MDPVAIENVTPEIECGRFPAKIVVNSKFTVTAEVFRAGHDLVYPVLMYRKLKKRWRSVAM
KGTGNDLYEASFTPDEPGIYEYKISAWKDSYGTLIRNINAWLGSNEDVEQDLIEAINLIK
DAYKRSSGNDKKIIKRYLDDLINSDLNKKVMILNDNNFSSIIKKYQKKIDKTDYRTLRLI
ADPEYGGYGSWYELFPRSIGNFNDIIKHLNYVKSMNFNVLYLTPIHPIGITNRRGKNGSR
ISDKNDPGSPWAIGNDSGGHYSINSDLGSLEDFKNLLRSAREKNIMIAMDIALQCSPDHP
YVRDHPEWFYHRPDGSIRYAENPPKKYYDIYPLNFETKNKMALWNEMKNIFLYWISNGVK
IFRVDNPHTKPLDFWEWLINDIKRDHPDVVFLSEAFTRENLMFELSKRGFTMSYTYFTWK
LTKGEITEYFKKLYSYPYNFFFRPMLFTNTPDILGRDLSMGRNEFIIRSVLASTLSSLWG
IYSGFELCENDRLDDTEEYLNSEKYEIKRRNFNSDNNIKDIIARLNSIRDEMPALRSGKI
KFCETDNDKIIAYARYNNENKILVVLNLDTMNVQSGFIRVPLNDFSMDLNSIYDVHDVLN
NNHYKWSGEYNYVRLIPGKRQAHIMVIKNA
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggatccagtggcaattgagaatgtaacaccggagatagaatgcggaaggtttccggca
aagatagttgtaaacagcaaatttacggtgaccgcagaggttttcagggcaggtcacgac
cttgtttatcccgttttaatgtacaggaaattaaagaaaagatggagatcagttgccatg
aaaggcaccggcaatgatctttatgaggcatcatttacaccagatgagccgggaatatac
gaatacaaaatatcggcctggaaggattcatacggcactttaataaggaacataaatgcc
tggcttggctcaaacgaggatgttgaacaggatctaatcgaggcaatcaatttaattaaa
gatgcatataaaagatcctcaggaaatgataaaaaaattattaaaagataccttgatgat
ttaattaattcagatttaaataaaaaggtcatgatactaaatgataataatttctcatct
ataataaaaaaataccagaaaaaaatagataaaacggattacagaaccttaaggctcatc
gctgacccggaatacggcggctatggttcatggtacgagctttttccaagatccattggt
aactttaatgatataataaagcatttaaactatgtaaaatcgatgaatttcaatgtttta
tatttaacgccaatacatccaattggcattacaaacaggcgcgggaagaatggatcaaga
atttcagataaaaatgatccaggaagtccatgggccataggcaacgattccggggggcat
tactcgattaacagcgaccttggcagccttgaggacttcaagaatcttttaaggtctgcc
agggaaaaaaacatcatgatagccatggatattgctctgcagtgctcccctgatcatcca
tatgtaagggatcatcctgaatggttttatcacaggcctgacggctcaataagatacgct
gagaatccgccaaaaaaatactatgatatatatccattgaactttgaaacaaaaaacaaa
atggcattatggaacgagatgaagaacatatttttatactggatttcaaatggtgtaaaa
atattcagggtagataatccacatacaaagcccctggacttctgggagtggcttataaat
gatataaaaagggatcatccggatgttgtgtttttatccgaggcctttacaagggaaaat
cttatgtttgaactttcaaagcggggctttacaatgtcatatacatattttacatggaaa
ttaacaaagggcgagataacagagtatttcaaaaagctttattcatatccatataatttc
ttcttcaggccgatgcttttcacaaacacaccggatatacttggaagagatctttccatg
gggagaaatgaatttataataaggtccgtgcttgcctcaacgctttcatccctgtgggga
atatactcaggatttgaactatgcgagaatgaccgccttgatgatacagaggaatattta
aactctgagaagtacgaaataaaaaggagaaattttaatagcgataataatataaaagat
atcatagcaaggttaaactcaataagagatgagatgccggcgcttagatctggaaaaata
aaattctgcgaaacggacaatgataagataatagcatatgcaaggtataacaatgaaaac
aaaattcttgtcgttttaaaccttgatacaatgaatgttcaatcaggttttataagggtt
ccattgaatgatttttcaatggatttaaattccatatacgatgtccatgatgttttaaat
aacaatcattacaaatggagtggtgagtacaattatgtcaggttaatacccgggaagcgc
caggcgcatataatggtgattaaaaatgcttga

DBGET integrated database retrieval system