KEGG   Picrophilus torridus: PTO0071Help
Entry
PTO0071           CDS       T00177                                 

Definition
trehalose synthase (EC:5.4.99.16)
Organism
pto  Picrophilus torridus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(79853..80227)
Genome map
AA seq 124 aa AA seqDB search
MIFMDKYEKILWSISFLIVFQMMTGFYLSQVRIPLKYLLYIHIFTGILIFLISIVLIRIS
GNTRLKRLSYVNMFLILFTGVIGLGFILLKLKFYDIYMPYIHFLLAIGIISNYAVMLGIS
RTLN
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgatctttatggacaaatatgaaaagatactctggtcaatatcctttttgatagttttt
caaatgatgaccggcttctatttatcacaggtaagaataccgttgaaatacttattatat
atccacatttttacaggaattttaatctttttaatctcaattgttttaataaggatctca
ggaaatactagattaaaaaggctttcatatgtaaacatgttcctgatattgtttacaggt
gttataggccttgggtttatactgttaaaattaaaattttatgacatttacatgccatat
atacatttcctgcttgccattggaattataagcaactatgcggtcatgcttggaatcagc
aggaccttaaattag

DBGET integrated database retrieval system