KEGG   Picrophilus torridus: PTO0141Help
Entry
PTO0141           CDS       T00177                                 

Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pto  Picrophilus torridus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PTO0141
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PTO0141
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PTO0141
Enzymes [BR:pto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PTO0141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(161587..162867)
Genome map
AA seq 426 aa AA seqDB search
MIRYDLKQSEMPRKWYNIIPDLPEEVPMPLDENGEAMELLKRAVPSKILEHEFSHERYID
IPEPVYEKYMMVGRPTPIIRAKKFEEYLGNNIKIYMKMESYTYTGSHKINSALAHVYYAK
QDNADFVSSETGAGQWGAAVSLAAALNNIKAHIFMVRTSYYAKPYRKFQMEMYGADVHPS
PSDFTAYGKELLKKDPENPGSLGIAISDAMKYALENNGKYIAGSVINADILYKTIAGQEA
LLQMKMTGDDPDYIIGVVGGGSNYAALAFPFLGEELRENNIRRKYIAAGSLEVPKMTRGV
YKYDFADTAGVLPMLKMYTIGADFIPPPVFAGGLRYHAVAPLLSLLMHRGIVSSRDYSQE
ESFKYAQLFSKIEGYIPAPETSHALPILKEIADEAERTHEKKTVLVSFSGHGLLDLANYA
DALGLK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgataagatatgatctaaagcagagcgagatgccaaggaaatggtataatattatacct
gatttacctgaagaggttccaatgccccttgatgaaaacggcgaggccatggaactgctt
aaaagggccgtaccatcaaagatccttgaacatgagttctcacacgaaaggtatatagat
ataccagagccggtttatgaaaaatacatgatggttggccgcccaacaccgataataagg
gcaaaaaaatttgaggaataccttggaaataatataaaaatatacatgaagatggaatct
tacacatataccggatcgcataaaataaacagtgccctggcacatgtatactatgcaaaa
caggataacgcagattttgtttccagtgaaaccggcgccggccagtggggggcagctgtt
tcacttgccgcggctcttaataatataaaagcacacatatttatggtcagaacgagctat
tacgcaaaaccatacagaaaatttcaaatggagatgtatggtgcagatgtccatccaagc
ccatcagattttacagcatacggaaaagaactattaaaaaaagatccagaaaatccgggg
tccctgggcatagcaataagtgatgcaatgaagtatgcacttgaaaacaatggaaagtac
attgccggcagtgttataaatgcggatatattatacaaaacaatagcaggccaggaggcg
cttttacagatgaagatgaccggtgatgaccctgattatataataggtgttgtcggtggc
ggttcaaattacgcggcccttgcatttccatttcttggtgaggagcttcgtgagaataat
ataagaagaaagtacatagctgccggctctcttgaggtaccaaaaatgacaaggggcgtt
tataaatatgattttgcagatacagcaggcgttcttccaatgctgaagatgtacacaatt
ggtgctgacttcataccgccacctgttttcgccggcgggttaagataccatgcagttgca
cctttgttaagcctgttaatgcatcgtggcatagtttcctcaagggactattcacaggaa
gaatcatttaaatacgcacagctgttctcaaagatagagggttatataccggcaccggag
acatcacatgcgctgccgattctaaaggaaatagcggacgaggccgagaggacccatgaa
aagaagaccgttcttgtaagcttctcaggccatggcctgcttgaccttgcaaactatgcg
gatgctcttggattaaagtaa

DBGET integrated database retrieval system