KEGG   Picrophilus torridus: PTO0177Help
Entry
PTO0177           CDS       T00177                                 

Definition
magnesium-chelatase subunit ChlI
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
pto  Picrophilus torridus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pto00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(207238..208224)
Genome map
AA seq 328 aa AA seqDB search
MEKGLGNRAMIAAVKSARAIAAYYGRKKPDKNDLDLALYFAMNHRSKDVKKPEINNNINN
DFDHKDNKDGSNENDKSSKNDYEIHNQKGNEKDVKSVEFRIKTSNDSGRVSTGSGFNRAS
FRPGSHLDIHGTLLNMAMNMDKSVMPYDLSFKSRISQGSMPFIIAVDASKSMKFKSRIND
AINISSMILKEAYVKRSRVSLVSFSGTQASLISWFSRNFSSIEASLRSIKSSGKTPLADA
LRLCADISKRYNKKTVSFFLTDGRGNYPDASYKRIYDAAEYLGRYSRVFVINDDDFLPGY
NKAIADASNGIILKKDENLIFEIKSRIL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaggtcttggcaacagggcaatgattgcagccgtgaaatcagcaagggccata
gccgcatattatggcaggaaaaaaccagataaaaatgaccttgaccttgcactttacttt
gcaatgaatcacagatcaaaggatgtaaaaaagccggaaataaacaataatataaacaat
gattttgatcataaagataataaagatggcagcaatgaaaacgataaaagcagcaaaaat
gattatgaaattcataatcaaaaaggcaatgaaaaggatgtaaaatccgtggagtttaga
ataaaaacatcaaatgattccggcagggtatctactggctccggatttaacagggcatca
tttagaccaggaagccatcttgatatccatggaacgcttttaaacatggccatgaacatg
gataaaagtgtaatgccatacgatctttcctttaaatccaggatatcacagggatcaatg
ccattcataattgccgtggatgcaagcaaatccatgaaatttaagagcagaataaatgat
gcgataaacatatcatcaatgatattaaaagaggcatatgtaaagagatcaagggtatcc
cttgtatccttctccggaacacaggcgagtttaatatcatggttcagcaggaactttagc
agcatagaggcctcattgagatccataaaaagctccgggaaaacgccactggcggatgct
ctaaggctctgtgccgatatttcaaaacgatataataaaaaaacggtatcattctttctc
acagatggccgtgggaactatcctgatgcgtcatataaaaggatatacgatgctgcagaa
taccttggaaggtacagcagagtctttgttataaacgatgatgactttttgccaggatat
aataaagcaatagccgatgcatcaaatggaattatattaaaaaaggacgaaaatttaatc
tttgagataaaatcaaggatattataa

DBGET integrated database retrieval system