KEGG   Picrophilus torridus: PTO0177Help
Entry
PTO0177           CDS       T00177                                 

Definition
magnesium-chelatase subunit ChlI
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
pto  Picrophilus torridus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PTO0177
Enzymes [BR:pto01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PTO0177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(207238..208224)
Genome map
AA seq 328 aa AA seqDB search
MEKGLGNRAMIAAVKSARAIAAYYGRKKPDKNDLDLALYFAMNHRSKDVKKPEINNNINN
DFDHKDNKDGSNENDKSSKNDYEIHNQKGNEKDVKSVEFRIKTSNDSGRVSTGSGFNRAS
FRPGSHLDIHGTLLNMAMNMDKSVMPYDLSFKSRISQGSMPFIIAVDASKSMKFKSRIND
AINISSMILKEAYVKRSRVSLVSFSGTQASLISWFSRNFSSIEASLRSIKSSGKTPLADA
LRLCADISKRYNKKTVSFFLTDGRGNYPDASYKRIYDAAEYLGRYSRVFVINDDDFLPGY
NKAIADASNGIILKKDENLIFEIKSRIL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaggtcttggcaacagggcaatgattgcagccgtgaaatcagcaagggccata
gccgcatattatggcaggaaaaaaccagataaaaatgaccttgaccttgcactttacttt
gcaatgaatcacagatcaaaggatgtaaaaaagccggaaataaacaataatataaacaat
gattttgatcataaagataataaagatggcagcaatgaaaacgataaaagcagcaaaaat
gattatgaaattcataatcaaaaaggcaatgaaaaggatgtaaaatccgtggagtttaga
ataaaaacatcaaatgattccggcagggtatctactggctccggatttaacagggcatca
tttagaccaggaagccatcttgatatccatggaacgcttttaaacatggccatgaacatg
gataaaagtgtaatgccatacgatctttcctttaaatccaggatatcacagggatcaatg
ccattcataattgccgtggatgcaagcaaatccatgaaatttaagagcagaataaatgat
gcgataaacatatcatcaatgatattaaaagaggcatatgtaaagagatcaagggtatcc
cttgtatccttctccggaacacaggcgagtttaatatcatggttcagcaggaactttagc
agcatagaggcctcattgagatccataaaaagctccgggaaaacgccactggcggatgct
ctaaggctctgtgccgatatttcaaaacgatataataaaaaaacggtatcattctttctc
acagatggccgtgggaactatcctgatgcgtcatataaaaggatatacgatgctgcagaa
taccttggaaggtacagcagagtctttgttataaacgatgatgactttttgccaggatat
aataaagcaatagccgatgcatcaaatggaattatattaaaaaaggacgaaaatttaatc
tttgagataaaatcaaggatattataa

DBGET integrated database retrieval system