KEGG   Picrophilus torridus: PTO0250Help
Entry
PTO0250           CDS       T00177                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pto  Picrophilus torridus
Pathway
pto00860  Porphyrin and chlorophyll metabolism
pto01100  Metabolic pathways
pto01110  Biosynthesis of secondary metabolites
pto01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PTO0250
Enzymes [BR:pto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PTO0250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AAT42835
UniProt: Q6L2G7
Position
282757..283425
Genome map
AA seq 222 aa AA seqDB search
MTMDTRFIVTTRPAEKYNEIKGSCFDVINIPVTRIVDLEPPVIDYKPDVIILTSEHGADL
FFKYYNLKGIFMAIGRKTGDEIKRHGINPLIPKDESSYGLINLLDKYKDKRIAMFRSMKS
NNIIRDYLIKNHFDFKEYFLYDIVPVNSDICNYINDDKCMGVVITSSMEAEIIVSMCHGI
KNAFAIGRVTEEKLRSMNINVIKTGRSDFIDLIKEIDKMYCK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgactatggatactagattcattgtaacaaccaggccggctgaaaagtataatgaaata
aagggatcctgctttgatgttataaacattccggtaacaaggatcgttgaccttgaaccg
ccggttatagattataaacctgatgtgattattctcacaagcgagcatggggcagatctg
ttctttaaatattataatttaaaaggcatcttcatggcaataggcagaaaaacaggagat
gagataaaaaggcatggaattaatccattaatacctaaggacgagagctcatatggtctg
ataaacctccttgataaatataaggataaaaggattgcaatgttcagaagcatgaaatca
aacaatataatcagggattatttaataaaaaatcactttgattttaaagaatacttttta
tatgatatagttcctgtaaatagtgatatatgcaattatataaatgatgataaatgcatg
ggtgttgttataacatcatcaatggaggctgaaataatagtatcaatgtgccatggtata
aaaaacgcattcgccattggaagggtcacagaggaaaaattaagatccatgaatataaat
gttataaaaacaggaagatctgattttattgatcttataaaggagatagataaaatgtac
tgcaagtag

DBGET integrated database retrieval system