KEGG   Picrophilus torridus: PTO0283Help
Entry
PTO0283           CDS       T00177                                 

Definition
(RefSeq) acetyl-coenzyme A synthetase (EC:6.2.1.1)
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pto  Picrophilus torridus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PTO0283
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PTO0283
   00620 Pyruvate metabolism
    PTO0283
   00640 Propanoate metabolism
    PTO0283
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PTO0283
   00680 Methane metabolism
    PTO0283
Enzymes [BR:pto01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PTO0283
Lipid biosynthesis proteins [BR:pto01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PTO0283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
316797..318749
Genome map
AA seq 650 aa AA seqDB search
MYSLMLNTIMSETLPTDERYNTSFSRYLDEYRRSIENTEEFWNEKSKIIEWFRDYDRVLD
DSKKPFFRWFVNGKTNVSYNCLDRHIKTDKRNKVAYIWVSESGNEKIVTYYGLYRRVNAL
ARGLLNMGLRKGDHVTIYMPMILEAPVAMLACARIGVVFNVVFSGFGAEALAERIKDSRS
KMVITADGAWRRGKIVELKSIVDRALELTENVESVIVVKNTNNEINMESERDFYYNDIIE
DGYVEPEKMDSNDPLFILYTSGTTGKPKGIVHGNGGYPVWISNTMKWAFDPKDEDRYWCA
ADIGWITGHSYIVFAPLLLGVTSIMYEGAIDYPKPDRVWDIIERYGVNILYTSPTAIRLL
MKYGDKYPNSHDLSSLKTLGTVGEPINPAAWHWFYEVIGKSRCPIIDTYWQTETGGFTIA
PALGLGLPDLKPGSATFPLPGIDPVILDDNGREVKRNEKGYIVLRRPWPGLMLTVNNDDK
RYIETYFSKFKDMYLMGDYAVKDDDGYIWLLGRADEVLKVSGHRIGTIEIEDALVSMKEI
AEAAVFGKPDTIKGDTIIAFVTLKEGYEKSPDLIDYFKRKIREELGPIMVPEEIHIVDSL
PKTRSGKIMRRVIKAVYLDQLPGDITTLENEASVDEIKRAVEELKRYTGD
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgtatagtttaatgttaaatactataatgagtgagacattaccaacagatgagagatac
aatacctcttttagcaggtatcttgatgagtacaggagatccattgagaacacagaggag
ttctggaatgaaaaatcaaaaataatagaatggttcagggactacgacagggttctggat
gattcgaagaagccattttttagatggtttgtcaatggaaaaacaaacgtttcatacaac
tgccttgacaggcatataaagaccgataaaagaaacaaggttgcatacatatgggtctca
gaatcaggaaatgaaaagatagtaacatactacggtttatacagaagggtcaatgccctt
gcaaggggacttttaaacatgggccttagaaaaggggatcacgttacaatatacatgcca
atgatacttgaggctccggttgcaatgcttgcatgtgccagaataggtgttgtgttcaac
gttgttttctctggctttggcgctgaggcacttgcagagagaataaaggattcaagatca
aagatggttataacagctgatggtgcatggcgccgtggaaagatcgttgagttaaaaagc
atagttgacagggcacttgagttaaccgagaacgttgagagcgtaatagttgtgaaaaat
acaaacaatgagataaacatggaatcagagcgcgatttctattacaatgatattatagag
gacggctacgttgaaccagagaaaatggattcaaacgatcctttgtttatattatacaca
tcgggaacgactggaaagccaaagggcatagtccatggcaacggcggttaccctgtatgg
atatcaaacacaatgaaatgggcctttgatccaaaggacgaggatagatactggtgcgcc
gcggatattggctggataaccgggcacagctatattgtctttgcgccgctgctccttgga
gtaacatcaataatgtacgagggcgcaatagattatccaaagccggatcgtgtctgggat
ataatagaaaggtacggtgttaacatattatacacgtccccaacggccataagattgtta
atgaagtacggagataagtatccaaattcacatgatctgagctcattaaaaacgcttgga
actgttggtgagccaataaacccggctgcatggcactggttctatgaggtaataggaaaa
tcaaggtgtccaataatagatacctactggcagaccgagaccggtggattcacaatagca
cctgcgcttggacttggacttcctgatttaaaaccgggctctgcaacatttccgctgcct
ggaatagatcctgtgatactcgatgacaatggaagggaggtaaagagaaacgagaaggga
tacattgttttaagaaggccatggcccggtttaatgctaacagtgaacaacgacgataaa
aggtacatagaaacctatttttcaaagtttaaggatatgtacttaatgggcgactacgcg
gtaaaggacgatgatggctacatatggctgcttggccgtgctgacgaggtattaaaggtc
tcagggcatagaataggaacaatagaaatagaggatgcacttgtatcgatgaaggagata
gccgaggcagctgtgttcggaaaacctgatacaataaagggcgatacaataatagcattt
gtaacattaaaggagggctatgaaaagagtcctgacctgatagattattttaaaaggaag
atcagggaagagcttggaccaatcatggttcctgaggagatacatatagtcgattcactg
ccaaagacaagatcaggaaagatcatgaggcgtgttataaaggccgtttatctggaccag
cttccaggggatatcacaacgcttgaaaacgaggcatctgtagacgagataaaaagggcc
gttgaggaattaaaaaggtacacaggtgattaa

DBGET integrated database retrieval system