KEGG   Picrophilus torridus: PTO0345Help
Entry
PTO0345           CDS       T00177                                 

Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pto  Picrophilus torridus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PTO0345
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PTO0345
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PTO0345
Enzymes [BR:pto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PTO0345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(381317..382054)
Genome map
AA seq 245 aa AA seqDB search
MRNLIPYFTLGYPDNETLKRFLMAMPINMINYIEFGFPSNDPRYDGPTIRKTHRIGNENY
DESFYIDIFNYFNDHNIKMYSLSYYSDIKDIERFAAVLSNLGFSGSIIPDLLIDYYDEAF
DVINKLNEMHFEYIPFFTPSTPDNVIKKVSEKTYSWIYYGLQPSTGIDIPYDLDYTCNRI
FSLVKSREINFGFGIKTIEDVSGLIRRGASGVAIGSYLVNMLDGNDLNGFLDYLKRIRGA
LDVES
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatttaataccatattttacacttggctatccggacaatgaaaccctgaaaagg
tttttaatggcaatgcccattaatatgataaattacattgaattcggatttccatcaaat
gacccaaggtatgatggcccgacaataagaaaaacccatagaataggcaatgagaactat
gacgaatcattttacattgatatattcaactactttaatgatcataatataaagatgtac
tcgctttcatactattcagacataaaggatatagaaaggttcgctgccgttctatcaaac
ctgggcttttcaggatcaataatacctgatttgttaatagattactatgatgaggccttt
gatgttataaacaaattaaatgagatgcattttgaatacataccgttcttcacgccctca
actcctgataatgtaataaaaaaggtatcagaaaaaacatactcatggatatactatggc
ctgcagccatcaacaggcatagacataccttatgatcttgattatacatgcaacaggata
ttttcacttgttaaatccagggagatcaactttggcttcggcataaagaccattgaggat
gtttcaggtttaataagacgcggggcctcgggcgttgccataggttcatatcttgtaaac
atgcttgacggcaatgacctgaatggttttcttgattatttaaaaaggataaggggtgct
ctcgatgttgaatcttga

DBGET integrated database retrieval system