KEGG   Picrophilus torridus: PTO0346Help
Entry
PTO0346           CDS       T00177                                 

Definition
(RefSeq) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pto  Picrophilus torridus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PTO0346
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PTO0346
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PTO0346
Enzymes [BR:pto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PTO0346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(382056..383315)
Genome map
AA seq 419 aa AA seqDB search
MSEEFKSLLSSDIIPENWYNVTPDLPEPLPPPRDTKSDFSSINLLNKILPKEVLKQEFTF
KRYEKIPDEIIDKYIQIGRPTPLIRAKNLEKYLDYGGKIFFKFEGATATGSHKINTAIAQ
AYYAMNENANGVTTETGAGQWGSATALAASLYNLKSQIFMVRVSYEQKPLRKVVMSLYNS
SVVPSPSNLTEFGRKILSENPDHPGTLGIGISEAVEYALDHNYRYMVASVMNAALTHQSV
IGQESIKQMELLGEFPDVLFGCVGGGSNFGGFAFPFLPINDDIEIYATTAQEVPKFSQGE
YKYDLMDTAGVLPAVRMYSLGADFVPPKIYAGGLRYHGAAPSLSLLINHGRIKSDEVTEE
QVKNAIKTFANTQGFIIAPESGHAVATAIKYAREHKDEKKTLLINVSGHGLLDLSIFSD
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaggaatttaaatcactgttaagcagcgatataatacccgagaactggtataat
gttacaccggatcttccggagccgttgccacctccaagggatacaaagagcgatttttct
tcaataaaccttttaaataagatactcccaaaggaggttttaaagcaggaatttacattt
aaaaggtatgaaaagataccggatgagatcattgataaatatattcagataggaaggcca
acgccattaataagggcaaaaaatcttgagaaataccttgattacggcggcaagatcttt
tttaaatttgagggcgcaaccgcaacaggttcgcataaaataaacaccgcgatagcacag
gcatactatgcaatgaatgagaatgcaaacggtgtgacaacagaaaccggtgccggtcag
tggggatctgccactgcccttgcagcatcactttacaatttaaaatcacagatattcatg
gtcagggtaagctatgagcagaagccattgagaaaggttgtaatgtctctttataatagc
agcgttgtgccaagcccgtcaaatttaacggaatttggcagaaagatattaagcgagaac
ccggaccatccaggaacgcttggaataggcataagcgaggctgtcgagtacgcactggat
cataattacaggtacatggttgcaagcgttatgaacgcagcattaacgcaccagagcgtc
ataggccaggaatcgataaagcagatggagcttctaggcgagtttcctgatgtcctgttt
ggatgcgttggcggcggcagcaactttggcggctttgcatttccgtttcttccaataaat
gatgatatagagatatatgcaacaaccgcacaggaggtgccaaagttctcacagggtgag
tacaagtatgatctaatggatactgcaggtgtgcttcctgctgttagaatgtacagcctg
ggtgcagattttgtgcccccaaaaatctatgccggtggtttaagataccatggcgcggca
ccatccctgtcattgcttataaaccatggaaggataaaaagcgatgaggttacagaggaa
caggtaaaaaatgctataaaaacctttgcaaacacccagggatttataatagcacctgaa
tcaggtcatgcagttgcaaccgcaataaagtacgcaagggagcataaggatgagaaaaaa
acactgcttataaacgttagcggccatggactgcttgatctatcaatattcagtgattga

DBGET integrated database retrieval system