KEGG   Picrophilus torridus: PTO0348Help
Entry
PTO0348           CDS       T00177                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pto  Picrophilus torridus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PTO0348
   01230 Biosynthesis of amino acids
    PTO0348
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PTO0348
   00051 Fructose and mannose metabolism
    PTO0348
   00562 Inositol phosphate metabolism
    PTO0348
Enzymes [BR:pto01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PTO0348
Exosome [BR:pto04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PTO0348
  Exosomal proteins of bladder cancer cells
   PTO0348
  Exosomal proteins of melanoma cells
   PTO0348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
383827..384486
Genome map
AA seq 219 aa AA seqDB search
MKPLIFINFKHYENATGRNAELLLNEFRKIKDQKNIYYCLGPGDLRLSLEFPDLNIYSQH
VDYNGYGPYTGSISMNFLKSINVNGSLLNHSEKRLEIDDIRKTIEYSKSHDFKLVVCAEN
IDEIKSISKLRPDYIAYEPRELIGGDISVSNAKPDIIRSASLICSGNDVKLLVGAGIKTE
NDIKASINLGASGVLIASGVIKDPKPINKLISLTGNITG
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaagccattgatttttataaattttaagcactatgaaaatgcaacgggcaggaacgcc
gagcttcttttaaatgaatttagaaagataaaggatcaaaaaaacatatattattgcctt
ggtcctggagatctaaggctgtcccttgagttccctgatctaaatatatattcacagcac
gttgattacaatggctatggcccttatacaggatcaatatcaatgaactttctcaagagc
ataaatgtaaacggatcgcttttaaaccattccgagaagaggcttgagatagatgacata
aggaaaacgatagaatactcaaaaagccatgatttcaagcttgttgtctgtgccgagaac
attgatgagataaaaagcatatcaaaattaaggccagattacatagcctatgagccaagg
gagcttataggcggcgatatctcggtatcaaatgcaaaacctgatattataagatctgca
tcattgatctgctccgggaatgatgtgaagctgctggttggtgccggcataaaaacggag
aatgacataaaggcatcgataaaccttggtgcctcgggtgttttaatagcctctggtgtc
ataaaggacccgaaaccaataaataagttaatttcattaactggtaacataacagggtaa

DBGET integrated database retrieval system