KEGG   Picrophilus torridus: PTO0365Help
Entry
PTO0365           CDS       T00177                                 

Definition
glucoamylase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
pto  Picrophilus torridus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PTO0365
Enzymes [BR:pto01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     PTO0365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(399014..401524)
Genome map
AA seq 836 aa AA seqDB search
MRKGTILKIIAILAVLIMVSSVTLFSYGHENSYKSSVVPVKKNIYFTGNLSRDFDGNIIG
INNHASPWGANNVIKKLYLAYNETDLFIGVYENISYNSLMIFITNVTNDIYGTSNISNMN
TWNRDITFEGTMNYFSAVYFDGNNINPAGYGTYAIMSGKNSTPLAKPINSTFAFFPGNNT
TEIAIPFSQMFQHGFNGNLSFGISAFVVGGSGPWVGSGIPYHQKGIYNDGNQASFLINDT
IEINIPGIHVSPLPSYVDYPSYLLMSNWKNNDFWIATGIPDSYLGNYSYVHLSMQTVNIE
NKILPLKFYFDIFGHSISARLTPNNTINVRTNNSEFELIDPPYMNQTDVIQKSKSTIYSY
ISMPYIKYNASGNQISLYKYNLTLFFVNSSYNINNDSGMLNISIVSGPGTSIIGLSTNST
YMNLDYIKDVNHANIMKWLSKSKVSISGRYLIEYNMSQLLVKDDQNPFTGEIVASPSPVY
FYNWVRDASFSAISLQDSGHIRSAMKYWDFMAGVQGVDTYNGTWQTRFNFWNGSVAGFVY
PEFDSVGLFEIGIYNLFQVTHNISVIQKFMPNILASLEFQEKSIKKYGFIAEDHSIWEME
YGYWFWTQAINYLGIRDISRMPMIQNHNAVPVPPGPVPPGNMNTAMIAHKLKSNIIKYFY
MDNIFAQYLVPVTNQYGDNNYTYFMANNTPDSSQILPIAMGFINPSSPMATSIVHNIYMI
LWNYRVGGLPRYYNDLYHYTEYGGYHESSGPSPPWIITTLFLALYDEKTGNMTGALNLMK
WSYSHSQSWLLPEAVDPNFGSVIASTSPLTWSSAMYIIVSLNYRAMPPAPLPPGPP
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagggcactattttaaaaattattgccatcctggccgttttaatcatggtctct
tctgtaacattgttttcctatggccatgaaaacagctataaaagcagcgttgttcctgta
aaaaagaacatatactttacaggaaatctatcaagggactttgatggaaatattatagga
ataaataaccatgcatctccatggggagcaaataatgtaattaaaaaactttatcttgca
tacaatgaaacagatcttttcattggtgtatatgagaatatatcatataatagtctcatg
atctttattacaaatgttacaaacgatatctatggaacatcaaatatttcaaatatgaat
acatggaacagggacataacgtttgaaggaacaatgaactatttcagtgctgtttacttc
gacggcaataatataaatccagcaggctatggcacatatgcaatcatgtcaggaaaaaat
tcaacgcccctggcaaaaccgataaacagcacgttcgcattctttccagggaataacaca
acagagatagcaataccattttcacagatgttccagcacgggtttaacggcaatttaagc
tttggcatatcagcatttgttgtaggcggcagcggtccatgggttggctccggaatacca
taccatcaaaagggaatctacaatgatggaaaccaggcaagctttttgataaatgataca
atagaaataaatataccaggaatacatgtaagtccgcttccgtcctatgttgattatcca
tcgtacctgctcatgagcaactggaaaaataacgatttctggattgcaacaggaataccg
gacagttaccttggaaattattcttatgtgcatctgtcaatgcagaccgttaacatagag
aataaaatcctgccattaaagttttactttgatatatttggccacagcataagtgcacgg
ctaacacctaacaatacaataaatgtaaggacaaacaactctgaatttgaattaatagat
ccgccatacatgaaccagaccgatgtaattcaaaagtcaaaatcaacaatttatagctat
atctcaatgccatatattaaatataatgcctcagggaaccaaataagtctttataaatat
aaccttacattattctttgttaattcctcgtataatataaataatgacagcggaatgcta
aatataagcatagtatcaggacccgggacaagcataattggccttagcacaaactcaaca
tacatgaatcttgattacataaaagatgttaatcatgcaaacatcatgaaatggctttca
aaatcgaaagtatcaatttcaggaaggtatttaattgaatacaatatgtcacagctgctt
gttaaggatgatcagaatccattcaccggagagatagttgcatcaccatcacctgtttat
ttttataactgggtcagggatgcatccttctcggcaataagccttcaggattccggccat
ataagatcggcaatgaaatactgggatttcatggcaggtgttcagggagttgatacatac
aatgggacctggcagaccaggtttaatttctggaatggcagcgttgccggctttgtatat
cctgaatttgacagcgtgggccttttcgaaattggtatatacaatctattccaggtaaca
cacaacatctctgtaatacagaaattcatgccaaacatacttgcatcactggaattccag
gagaaatcaataaaaaaatacggtttcatagcagaggatcacagcatatgggaaatggaa
tacggttactggttctggacacaggcaataaactatctgggtatcagggacatctcaaga
atgcccatgattcaaaatcataatgctgtgccggtacctccggggccggttccaccaggg
aacatgaatactgcaatgattgcgcataaattaaaatccaatataattaaatacttttac
atggataacatatttgcacagtaccttgtacctgtgacaaaccagtatggagataataat
tacacatatttcatggcaaataataccccggattcatcacagatactgccaatagcaatg
ggattcataaatccatcatcaccaatggccacatcgatagtgcataatatatacatgata
ctatggaattaccgcgttggcgggctgccaaggtattataacgatctttatcattacaca
gagtacggtggctatcatgaaagctctgggccgtcaccaccatggatcataacaacgctc
ttcctggcgctttacgatgaaaaaacaggcaacatgaccggcgcattgaatttgatgaaa
tggtcatacagccattcacagagctggctacttccggaggctgttgatccaaactttggc
agtgtaatagcatccacgtcgccattaacatggtcatctgcaatgtacataatcgtttcc
ttaaattatagagcaatgcctccagcaccattgccgcctgggccaccataa

DBGET integrated database retrieval system