KEGG   Picrophilus torridus: PTO0418Help
Entry
PTO0418           CDS       T00177                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pto  Picrophilus torridus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PTO0418
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PTO0418
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PTO0418
Enzymes [BR:pto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PTO0418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
446046..447032
Genome map
AA seq 328 aa AA seqDB search
MKIRCISCGRDRKGNELFCECGSPFEIIPDFKYYDDINRNFPYIKRFISLGEVETPVIKR
HNFSMKLDYFSPTFSYKDRGSRTLISYVNDLKINEINEDSSGNAGASIAGYGAAAGIKVK
IFVPENASAAKLRQIMSYGAQVIKIKGSRDDVQRAAQESGGFYASHILRPEFRDGIRTLA
YEIFNQGMPDHIYVPVSAGTLLLGLYSGLKHLYESSEIKTMPKIIGVQPENISPVCSRLN
NIKYDPDNNLTSIADALVSKRPVLIERMLEALYKCISVSEEEIKIARDELAASGIYVEYS
SATVYAAYKKVRLDNSMLILTGNGLKNQ
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaagataagatgcatatcctgcggaagggatagaaaaggaaatgaattattttgtgaa
tgtggttctccatttgagattattccagattttaaatattatgatgatataaatagaaat
tttccatatataaagaggttcataagccttggcgaggtggaaacccctgtaataaagagg
cataatttttcaatgaaacttgattatttctcgccaacgttctcatacaaggatcgtggt
tcaaggacgttaatatcgtatgttaatgatcttaaaataaatgagataaacgaggattct
tcagggaatgccggtgcatcaattgccggctatggtgctgccgccggaattaaggtaaaa
atttttgttcctgagaatgcaagcgccgcaaaattaaggcagattatgagctatggtgca
caggtaataaaaataaaaggttcaagggatgatgttcagagggctgcccaggaatctggt
ggtttctatgcaagccatatacttaggccggagttcagggatggcataagaactctggca
tacgaaatatttaatcagggcatgccggatcatatatatgtgccggtatctgcaggaacc
ctgttgcttggcctttattcaggattgaagcacctttatgaatcatctgaaataaaaacc
atgccaaagatcataggtgtccagcccgaaaatatatcaccggtatgctcaaggcttaac
aacattaaatatgaccctgataataacttaacgtccatagccgatgctcttgtatcaaaa
agacccgtgcttattgaaaggatgcttgaggcactttataaatgcatatctgtatccgag
gaggaaataaaaatagcaagggatgagcttgcggcgtcaggcatatacgttgagtacagc
tcggcaacggtttacgcggcctacaaaaaggtgagacttgataattcaatgctgatactc
acaggaaatggattaaaaaatcagtga

DBGET integrated database retrieval system