KEGG   Picrophilus torridus: PTO0501Help
Entry
PTO0501           CDS       T00177                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pto  Picrophilus torridus
Pathway
pto00010  Glycolysis / Gluconeogenesis
pto00620  Pyruvate metabolism
pto00640  Propanoate metabolism
pto00680  Methane metabolism
pto00720  Carbon fixation pathways in prokaryotes
pto01100  Metabolic pathways
pto01110  Biosynthesis of secondary metabolites
pto01120  Microbial metabolism in diverse environments
pto01130  Biosynthesis of antibiotics
pto01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PTO0501
   00620 Pyruvate metabolism
    PTO0501
   00640 Propanoate metabolism
    PTO0501
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PTO0501
   00680 Methane metabolism
    PTO0501
Enzymes [BR:pto01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PTO0501
Lipid biosynthesis proteins [BR:pto01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PTO0501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding_C AMP-binding
Motif
Other DBs
NCBI-ProteinID: AAT43086
UniProt: Q6L1R6
Position
complement(528122..528766)
Genome map
AA seq 214 aa AA seqDB search
MRPGSAGLPLPGHAFKIIDDTGKEVKTGEAGTLVITKPFPSLARSIWNDHNKYINQYFSV
FPNFYCTYDSAIKDKFGHIWVIGRTDDVINVSGHRISTMEMENSIMSVPDISEAAVIGID
HEIKGTVPYVFFTSKNTDNELKNKISSAIESSIGRFAMPEKIIIIPEMPKTRSGKIMRRL
LKEIVMHGDVSGDITGLENPDSINIIKNAINNQK
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgagacccggatctgcaggcctgccattgccaggacatgcatttaaaataattgatgat
acaggtaaagaggttaaaacaggtgaggccggaaccctggttataacaaagccgtttcca
tcactggcaaggtcaatctggaacgatcataataaatatataaatcaatatttttcagtt
ttcccaaatttttactgtacatatgattctgcgataaaggataaatttggacacatctgg
gttataggacgcacggacgatgtaataaacgtatcaggccacaggatatctacaatggag
atggaaaactcaattatgtctgttcctgatatttcagaggctgcagttattggaatagac
catgaaataaaaggcacggttccgtacgtgttttttacatcaaaaaacacagataacgaa
ctaaagaataaaatatcatcggcaatagaatcatcaataggcagattcgcaatgcctgaa
aagatcataattataccagagatgcctaaaacaaggtctggaaagatcatgaggcgtctt
ttaaaggaaatcgtaatgcatggtgatgtatcaggggatataacaggtcttgaaaatcca
gattcaataaatattataaagaatgctataaataatcaaaaataa

DBGET integrated database retrieval system