KEGG   Picrophilus torridus: PTO0551Help
Entry
PTO0551           CDS       T00177                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pto  Picrophilus torridus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pto00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(576430..577398)
Genome map
AA seq 322 aa AA seqDB search
MTFYTDPDDGRYILFYHINGEPLIRNKKIVPERLEKNVENVSMIIENYDFLSPFKDIIIK
NIFGKRETKIMGILNATPDSFFPGSRVGSDDKIYEMLEEKPDIIDIGGESTRPGSSEVDP
ETEIKRLEGVLNILKSYNIKISIDSRHYRVIEALLKRYDIDYINDISGFIDKRMIKMASE
YKKKCIVMHMRGEPQNMNKFTDYDDIFFEINAFFFDRIKNMINSGIEPENIIIDPGIGFS
KNYEQNIKLIKSPWSFAFGFKTLYGTSRKSFIGKITGNDVNKRLGSTIATSIYLAMNNVD
ILRVHDVSENRSAIELYKMLVT
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacgttttacacggatccggacgatggtagatatatacttttttatcatataaacggc
gagccattaataagaaataaaaaaatagttccggagaggctggaaaaaaacgttgaaaat
gtatcaatgataatagaaaattacgattttctatcgccctttaaggatattataataaaa
aacatttttggtaaaagggaaacaaagatcatgggaatattaaatgcaacaccggactca
ttcttcccgggatcaagggtaggcagcgatgataaaatatatgagatgcttgaagaaaag
ccggatattatagatataggtggtgaaagcaccagacccggcagctcagaggttgaccct
gaaacagagataaaaagactcgaaggtgttctaaacatattgaaatcatataatataaag
atttctatagattcaaggcattacagggtcatagaagcactattaaaaagatatgacata
gattacataaacgatatttccggctttatcgataaaagaatgataaagatggcctctgag
tataaaaaaaagtgcatagttatgcacatgcgtggtgagccacagaacatgaacaaattc
acagattatgatgatatattctttgagataaatgcctttttctttgatagaataaaaaac
atgataaattctggaatagagcctgaaaatataataattgaccccggaattggcttttca
aagaattatgagcaaaatataaaattgattaaaagcccgtggtcatttgcctttggcttt
aaaaccctgtatggtacatctagaaagagcttcataggtaaaataaccggaaacgacgtt
aataaaagacttggcagcaccattgcaacatcaatataccttgcaatgaacaatgtggac
atattaagggttcatgatgtttcagagaacaggtctgcaatagaattatataaaatgctt
gttacgtga

DBGET integrated database retrieval system