KEGG   Picrophilus torridus: PTO0564Help
Entry
PTO0564           CDS       T00177                                 

Definition
(GenBank) pyridoxal-phosphate dependent enzyme
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pto  Picrophilus torridus
Pathway
pto00260  Glycine, serine and threonine metabolism
pto00750  Vitamin B6 metabolism
pto01100  Metabolic pathways
pto01110  Biosynthesis of secondary metabolites
pto01120  Microbial metabolism in diverse environments
pto01230  Biosynthesis of amino acids
Module
pto_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PTO0564
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PTO0564
Enzymes [BR:pto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PTO0564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP 7kD_coat
Motif
Other DBs
NCBI-ProteinID: AAT43149
UniProt: Q6L1K3
Position
complement(592215..593162)
Genome map
AA seq 315 aa AA seqDB search
MNEIISSLEEEKPPGSPLLSGAYLRGIIDSDRVFVKYEGANPTGTQKDRISENHVKRALS
LGMKTVSVATCGNYGASISYYSRKYNIDAVIGIPEYYSNVRSKEMVANGSRVIKYPYKYE
EIVELFHKISERNGWYDASPGSRNDVYDIIGYSIIAIEIYKQLGHSPDYIAVPVGNGTTL
AGIYYGFRALYDYGYASNVPRFIAASTSGGNPIVESYMNGSKKIMELSEEKIRETNINEP
LVAYRSYDGQKALDALYDTEGYAFYVNDDEMINASHLMKMNGLSVLPASASAAVAAARVL
KNNDECVIVITGRDH
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaataatcagttcacttgaagaggaaaagcctccaggtagtccacttttatca
ggagcctacctcagaggtataattgacagtgatagggtttttgttaaatatgagggcgca
aatccaactggcactcagaaggacagaatttctgagaaccatgttaagagggcgctgtct
cttggaatgaaaactgtatctgttgcaacctgcggcaattacggggcatcgatatcatat
tattcaagaaagtataacatcgatgctgttataggaatacctgagtactattcgaatgtt
agatcaaaggagatggttgcaaacggttcaagggtaataaaatatccttacaagtacgag
gagatcgttgaattgttccataagatctcagagaggaatggatggtatgatgcaagcccc
ggttcaaggaatgatgtttacgatattataggatattcaataatagcaatagagatatat
aaacagcttggccattccccggattacatagccgtgcccgttggcaatggaacaaccctt
gcaggcatatactatggcttcagggccctttacgattatggatacgcctcaaatgtcccg
agattcattgcagcaagcacctctggcggtaatccaatagtagaatcatacatgaatggt
tccaaaaaaataatggaattaagcgaggaaaaaataagggaaacaaacataaatgagccc
ctggtggcttaccgctcatacgatgggcaaaaggcccttgatgcactctatgatacggaa
ggttacgcattttatgtaaatgatgatgaaatgataaatgcatcacatttaatgaagatg
aatggactttctgttttgcccgcatcggcatctgcggccgttgccgcggcgagggtatta
aaaaataacgatgagtgcgttatagttataacaggtcgtgatcactaa

DBGET integrated database retrieval system