KEGG   Picrophilus torridus: PTO0757Help
Entry
PTO0757           CDS       T00177                                 

Definition
(GenBank) zinc-binding dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pto  Picrophilus torridus
Pathway
pto00010  Glycolysis / Gluconeogenesis
pto00071  Fatty acid degradation
pto00350  Tyrosine metabolism
pto00625  Chloroalkane and chloroalkene degradation
pto00626  Naphthalene degradation
pto01100  Metabolic pathways
pto01110  Biosynthesis of secondary metabolites
pto01120  Microbial metabolism in diverse environments
pto01130  Biosynthesis of antibiotics
pto01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PTO0757
  Lipid metabolism
   00071 Fatty acid degradation
    PTO0757
  Amino acid metabolism
   00350 Tyrosine metabolism
    PTO0757
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PTO0757
   00626 Naphthalene degradation
    PTO0757
Enzymes [BR:pto01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PTO0757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: AAT43342
UniProt: Q6L110
Position
complement(771178..772188)
Genome map
AA seq 336 aa AA seqDB search
MKAALLYKNEKKLRIEDVPVPEINDDEVLIKVKAAGICHTELHFIDNVLNAGKYPIIPGH
EVAGIVYKKGKNVKDLDLNDKVLLYYYRGCGKCDFCINGQENLCTNPEMEYGFINDGGFS
EYIKARETDLVKLNDDIDIYSIAPIACSISTGIHALNMAKPELNDRVLVYGVGGVGFGLI
QLNKLRGCRVFSASRNDKKLDIAKKLGSDYNINTCNENIVNKVKSMGGVDIIYDLVGSNE
TIKNDIEMLNKAGKLVLIGYDGSNVNINPLDLIINEIKIISCVGNTRYELEEAVRLFNEN
RIKIVIDRFDELKNINNDLEIIRNGEAMGRIVIKFD
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcattattatataaaaatgagaaaaaactgagaatagaggatgttcctgtt
ccagagataaacgacgatgaggttctaatcaaggtaaaggctgcagggatatgccataca
gagttacatttcattgataatgttttaaatgccggtaaatatccgattataccagggcat
gaggttgccggaatagtatacaaaaaaggtaaaaatgtgaaggatcttgatttaaatgat
aaggtgcttttatattattaccgtggctgcggtaaatgtgatttctgcattaatggccag
gagaacctatgcacaaatccggaaatggaatatggatttataaatgacggcggcttttca
gaatatataaaggccagggagactgaccttgtaaagctcaacgatgatatcgatatatat
tcaattgccccaatagcatgcagcataagcaccggaatacacgcattaaacatggccaaa
ccggaattgaatgacagggttcttgtttacggtgttggaggcgttggcttcggattgata
cagcttaataaattaaggggctgcagggttttttctgcatcaagaaatgataaaaaactg
gacattgcaaaaaagcttggctctgattataatataaatacatgcaatgagaatatagta
aataaagtaaaaagcatgggcggtgttgatattatatacgatcttgttggttcaaatgaa
acaataaagaatgatatagaaatgctgaataaggctggtaaactggtattaataggctat
gacggcagtaatgtaaatataaatccgctggatctgataataaatgaaataaaaataata
tcatgcgttggtaatacaagatacgagctggaagaggctgtaagattatttaacgagaac
aggataaaaattgtaatagacagatttgatgaattaaaaaatataaacaatgaccttgag
ataataagaaatggcgaggccatgggcagaatcgtaataaaatttgattaa

DBGET integrated database retrieval system