KEGG   Picrophilus torridus: PTO0807Help
Entry
PTO0807           CDS       T00177                                 

Definition
dihydroorotate dehydrogenase (EC:1.3.3.1)
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
pto  Picrophilus torridus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PTO0807
   01230 Biosynthesis of amino acids
    PTO0807
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PTO0807
   00030 Pentose phosphate pathway
    PTO0807
   00051 Fructose and mannose metabolism
    PTO0807
  Energy metabolism
   00680 Methane metabolism
    PTO0807
Enzymes [BR:pto01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     PTO0807
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     PTO0807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
824775..825911
Genome map
AA seq 378 aa AA seqDB search
MKVTISHIKADIGSLPGHTTVFEPVVDAVEDYIKSNGKNIISDYRISHIGDDIQITMVHN
HGVDNPDVHGLAWNAFKAGTEVAKKYGLYGAGQDLLKDAFSGNVKGMGPGVAEMEITPRK
SEPFIVYMMDKTEPGSFNYPIYKMFGDPFNTPGLVIDPNMHAGFKFEVWDIIEGKRIMLS
LPEQTYDLLALIGSKGRYVIKRVYTKEEHTKLPAENVAVISTDKLSFIAGEYVGKDDPAA
VVRIQSGLPAAGEALEPFANSYLVSGWMRGSFNGPLMPVGIKNSRMTRFDGPPRVAALGF
VLKDGRLAGPVDMFDDIAFDYARTKALEMADYLRRMGVFEPHRLPDDDMEYTALPKILEK
LSSKFEKLSDLNELKEVQ
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttacaataagccatataaaggcagatataggcagcctgccaggacataccaca
gttttcgagcctgttgttgatgctgttgaggattatataaaatcaaatggtaagaatata
ataagtgattacagaatatcacatataggtgatgatatacagataacaatggttcataat
catggtgtggacaacccggatgttcatgggcttgcctggaatgcatttaaggcaggcacc
gaggttgcaaagaagtacgggctttacggtgccggtcaggatcttttaaaggatgcgttt
tcgggaaacgtcaagggcatgggtcctggcgttgctgaaatggagataacaccgagaaag
tcagagccgtttattgtttacatgatggataaaacagagccagggtcctttaattatcca
atatataaaatgtttggagatccattcaacacgcccggcctggtaatagatccaaacatg
catgccggattcaaatttgaggtctgggacataattgagggaaagcgcataatgctatca
ttgcccgagcagacctatgatctgcttgccctgataggctcgaagggaagatacgtaata
aaaagggtttatacaaaggaagagcacacaaaactgcctgcagaaaacgttgctgtaata
tcaacggataaactatcattcatagcaggagaatacgtcggaaaggacgatccggctgcg
gttgttagaatacagtcaggtcttcctgccgcaggtgaggcactggaaccatttgcaaat
tcttaccttgtttcaggatggatgcgtggctcattcaacggtccgttaatgccggttgga
ataaaaaactccagaatgacaaggttcgatggcccgcccagggttgctgcgcttggcttc
gttttgaaggatggcaggcttgcaggaccggttgatatgtttgatgatatagcatttgac
tatgccagaacaaaggcactcgaaatggcagattatctgaggcgcatgggtgttttcgaa
ccacacaggcttcctgatgatgatatggagtacaccgcgcttccaaagatacttgaaaag
ctttcatcgaaattcgaaaagttaagcgatttaaatgagctaaaggaagtgcaataa

DBGET integrated database retrieval system