KEGG   Picrophilus torridus: PTO0943Help
Entry
PTO0943           CDS       T00177                                 

Definition
(GenBank) mRNA 3'-end processing factor
  KO
K07577  
putative mRNA 3-end processing factor
Organism
pto  Picrophilus torridus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
959676..960893
Genome map
AA seq 405 aa AA seqDB search
MGGAEEVGRLAIKIEDKNDKIMIDYGVEPDKPPEYPLPPEPVNDIFITHAHLDHTGALPV
YYHNYSAKLHATAMTANSVVPIINDSLKIMRLENYVERFNEDDVENLFRSLVTERYNTDI
ELNNLTARAYSAGHIPGSSMWRFEDSFSFMITGDLYTRDTNLLKGARPVKTDVLIMESTY
AGRDHEDRDEVIKRLKDSIKETIDNGGKVILPTFAIGRTQEMIMILRDMNYNIYVDGMGN
DISRIYLDTPGFLKDYSLFRKSLGRVIKVRNKRMRKEALENGDIIITTSGMLDGGPVLGY
IDSLSDDPKSAIYLTGYQVEGTNGRSLMENGTIKIAGATIKPSMKIDFFDLSAHAGHSDL
VKFIKDIDPGTVVLCHGDQREKLKEALPEYNFILPYNGHEFEITN
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
ttgggaggagccgaggaggttggaaggcttgcaataaaaatagaggacaagaacgataaa
ataatgatagactacggtgttgagccggataagccaccggagtatccgttaccgcctgaa
ccggtaaacgatatttttataacacatgcacaccttgatcatacaggtgcacttccggta
tattaccataactacagtgcaaagcttcatgcaactgcaatgacggcaaacagcgtggtt
ccaataataaacgattcactaaagatcatgaggctggaaaactacgttgagaggttcaat
gaggacgatgttgaaaacctttttaggtctcttgtaactgaaaggtacaatacggatata
gagctgaacaatcttactgctagggcctacagtgccggtcatataccaggatcaagcatg
tggcgctttgaggattctttctcatttatgataacaggtgatctatacacaagggataca
aaccttttaaagggggcaaggcctgtaaaaaccgatgttttgattatggaaagcacatat
gcaggcagggaccatgaggaccgtgatgaggtaataaagagattaaaggacagcataaag
gaaacaatagacaacggcggcaaggttatacttccgacctttgcaataggcagaacacag
gaaatgatcatgattctcagggacatgaattacaacatttacgttgatggcatgggcaac
gatatatcaaggatataccttgatacaccaggattcctgaaggattattccctgttcaga
aaatccctcggcagggttataaaggtaagaaacaaaagaatgagaaaggaggccctggaa
aacggcgatataataataacaacatcaggcatgcttgatggcggcccggttcttggatat
atagactcattatcagacgatccaaagtctgcaatatatcttacaggataccaggtggag
ggcacaaacggaagaagcttaatggagaatggcacaattaaaatagccggcgcaacgata
aaaccctcaatgaagatagatttctttgatctatcagcccatgccggacacagtgatctt
gttaaattcataaaggatatagatccagggacagtggttttatgccatggcgatcagagg
gaaaaacttaaggaggcactgccagaatacaattttatacttccatacaatgggcatgag
tttgaaataacaaattag

DBGET integrated database retrieval system