KEGG   Picrophilus torridus: PTO0950Help
Entry
PTO0950           CDS       T00177                                 

Definition
(GenBank) phosphoribosylamine--glycine ligase
  KO
K01945  
phosphoribosylamine---glycine ligase [EC:6.3.4.13]
Organism
pto  Picrophilus torridus
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PTO0950
Enzymes [BR:pto01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.13  phosphoribosylamine---glycine ligase
     PTO0950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(966745..968001)
Genome map
AA seq 418 aa AA seqDB search
MKIMLVGSGGREDSIARNIALNHELYSVLTNENPSIIKNSKKYIFYDKKRHDLIADFALK
NNIDIAFVSPDGILANGLADDLIKNKIKTASPVKSAAMIETSKAYMRYIMEKYNIPGNIE
NATFNNKDAARDYITSMKDVAVKPIGLTGGKGVKVTGIHLNSDEAIRYACDIIDRDGQVL
IEKKETGEEFSLQAFSDGSHLSFMPVVQDYKRLYEGDHGPNTGGMGSISDRDFSLPFLRK
DTPERAKKILNKIIEAMKDENNVFKGIIYGQFMETDNDVKVIEINARFGDPEAINVNYIL
DDDLGIIFHDILSGNVNRSIKYMRKATVLKYIVPPGYPENPSKVRIKIDKTLNSDVYYAS
VSGTLNDVETLGSRSIAIIARGDSIEDAYLKCESDLNAIHGEFYVRHDIGDIRKKIKN
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcatgcttgttggcagcggcggcagggaggattcgatagcaagaaacattgca
ttaaaccatgagctttattctgtgttaaccaatgagaacccgtccataattaaaaacagt
aaaaaatacattttttatgataaaaaaaggcacgacctcatagcagactttgcattaaaa
aataatatagatatcgcctttgtcagccctgatggcatactggcaaatggccttgccgat
gatcttataaaaaataagataaaaacagcatcacctgtaaaaagtgcggcaatgatagaa
acatcaaaggcatatatgagatacataatggaaaagtacaatatacctggaaacattgaa
aatgcaacttttaataacaaggatgccgcaagggattacataacatcaatgaaagacgtt
gctgttaaacccattggattaaccggtggcaagggcgttaaggttaccggcatacattta
aattccgatgaggcaataaggtatgcctgtgatataatcgatagggacggccaggtttta
atagaaaaaaaggaaaccggcgaggagttctcacttcaggccttttccgatggttcacat
ctatcctttatgcctgtagtccaggattataaaagattgtatgagggcgatcatggacca
aataccggcggcatgggttccatttcagatagggatttcagcctgccctttttaagaaag
gacacgcctgaaagggccaaaaaaatacttaataaaattatagaggccatgaaggatgag
aataatgtatttaaaggaattatatacggccagttcatggaaactgataatgatgtaaag
gtaatagagataaacgcaagatttggcgatcctgaggcgataaatgttaattacatactc
gatgatgatttgggcattatattccatgatattttatccgggaacgttaacaggagtata
aaatacatgagaaaggcaactgttcttaaatacatagtcccgcctggatatccggaaaac
ccatcaaaggtaagaatcaaaatagataaaacattgaattcagatgtttactatgcctct
gtttcaggaactttaaatgatgttgaaacccttggatcaagatcaattgcaattattgca
cgcggcgattccatagaggatgcatatctaaaatgcgagtccgatctaaacgccattcat
ggtgaattctatgtaaggcatgacataggtgatataagaaaaaagattaaaaattga

DBGET integrated database retrieval system