KEGG   Picrophilus torridus: PTO0953Help
Entry
PTO0953           CDS       T00177                                 

Definition
(GenBank) cysteine synthase
  KO
K01738  
cysteine synthase A [EC:2.5.1.47]
Organism
pto  Picrophilus torridus
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PTO0953
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PTO0953
Enzymes [BR:pto01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     PTO0953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
968880..969644
Genome map
AA seq 254 aa AA seqDB search
MYSISGSMYSYGIGNTPLLNLDGIYAKAEYKNKFGSIKDRAAFFMISSVMDKIGNKIIVE
ASSGNTGIAVAGISRELGIKSIIVIPEGASDGTKAMLSRIGVDYITTPGNSTEQSIKYVE
NLIKSDPQKYLRLNQHSNDMNYLSHYMTTAPEIEHDMGKPDTIVIGIGTGGTISGISKYF
KEKYHDVKVIGIIPDENSRIFGLRNPFLSVNHGIIDKNINYIDDVFIISEDAALKGVSEL
LSKYNLFCRPLVGC
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtacagtatatcaggctcaatgtattcttacggcataggaaatacacctcttttaaat
ctcgatggaatctatgcaaaggcagagtataaaaataaatttggctcgataaaggacagg
gccgcattttttatgatctcatcggttatggataaaatcgggaataaaattatagtcgag
gcatcatcaggcaacacaggcatagcagttgcaggtatttcaagggagcttggcataaaa
agcattattgtaatacccgagggtgccagcgatggaaccaaggccatgctttcaagaatc
ggtgttgattacataacaacgccaggcaatagcacggaacagtcaataaaatacgttgaa
aatcttataaaaagtgatccccaaaaatatttaaggttgaaccagcacagcaatgatatg
aattatctatcacattacatgacaacagcacctgagatagaacatgacatgggaaagccc
gatacaatagtcattggcattggaaccggcggtacaatatcaggaatatcaaaatacttt
aaggaaaagtaccatgatgttaaggttataggaataatacctgatgaaaactcacggatc
tttggacttagaaatccatttttatccgttaatcatggaataatagataaaaatattaat
tatatagatgatgtgtttataataagtgaggatgcagccttaaagggcgtttcagagctt
ttaagcaaatacaatttattttgtaggcccctcgtcgggtgctaa

DBGET integrated database retrieval system