KEGG   Picrophilus torridus: PTO0954Help
Entry
PTO0954           CDS       T00177                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family
Organism
pto  Picrophilus torridus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(969736..970452)
Genome map
AA seq 238 aa AA seqDB search
MIIDENDEYLIIRMDNGLNTLDVDAIKEITDNISKRKPTIITGNDKAFSAGANVKKFLGL
SKSDAYNISRQAHEMLLKITGNSMPVIAAIKGYALGGGFELALACDLRFADLDAKFGFPE
IKLGIIPGWGGTQRLKPLIGETRAMEMILTGKIIDSNQAFSLGILNYIGGDYMNRAIDMA
SSIYNKSHEAVSAIKYLLRQGSLDLEMERFAGLFDEYNSKEGINAFLEKREPKFNLND
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgataattgatgagaatgatgaatacctgattataaggatggataacggactgaacaca
ctggatgttgatgcaataaaggagataacagataatatatcaaaaaggaagccgacgatt
ataacaggtaatgataaggcattctctgcaggtgcaaatgtaaaaaagttccttggcctg
tcaaagagcgatgcatataatataagcaggcaggcacatgaaatgcttttaaagataacc
gggaacagcatgcctgttattgctgcaataaagggctacgcccttggtggtggctttgag
cttgcgctggcatgcgatctcaggtttgcagatctggatgcaaaatttggcttccccgag
ataaaacttggcataatacctggctggggcggaacccagagattaaaaccattaataggc
gagaccagggcaatggagatgatattgacaggaaaaataatagattcaaatcaggcattt
tcacttggaatattaaattatatcggcggcgattacatgaacagggccattgacatggcc
tcaagcatatacaataaatcacatgaggcggtatccgccataaaataccttttaagacag
ggatcgctggatcttgagatggagagattcgcaggcctctttgatgaatacaattcaaaa
gagggcataaatgcattccttgaaaagagggagccaaaatttaatttaaatgattga

DBGET integrated database retrieval system