KEGG   Picrophilus torridus: PTO0960Help
Entry
PTO0960           CDS       T00177                                 

Definition
(GenBank) carbon-nitrogen hydrolase family
Organism
pto  Picrophilus torridus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(975049..975819)
Genome map
AA seq 256 aa AA seqDB search
MIRIALTQIHSSMDKESNLEKLRKYTEIAASNGADLIVFPEYFMFYSNDKKYLNENAEPI
NGIWVKNVIKIFNENSISGIVCINELNDNNVFDTAVYISGDVKGYYRKKMLYDAFGYRES
DIYKSGNGPFNLYRINDISFGILICYEIRFPELFRNYSKNGADMIIIPSGWFSGPVKEEQ
WLSLLRARALENTVYIASSNQIYGDFTGISAVADPIGIISERAGESETMIFYDVKKERIN
DVRQKMPLLEQLNNLR
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgataaggatagcattaacccaaatccatagttcaatggacaaggaaagtaatcttgaa
aagttaagaaaatacacggagattgcagccagcaacggtgcagacctaatagttttccct
gaatattttatgttttatagcaatgataaaaaatatctaaatgaaaacgcggaacctatt
aacggtatctgggtaaagaatgttattaaaatattcaatgaaaattccataagcggcata
gtatgtataaatgaattaaatgataataacgtctttgatactgcagtatacatatcaggt
gatgtaaagggttactacagaaagaaaatgctttatgacgcctttggttacagggaatca
gatatttataaatccggaaatggtccattcaacctttacaggataaatgatataagcttc
ggtattttaatatgttatgagataagatttcctgaactgttccgcaattattcaaaaaat
ggcgccgatatgataataataccatcaggctggttttccggccctgtgaaggaagagcag
tggctttcacttttaagggcaagggcccttgagaataccgtttacattgcaagctccaac
cagatttacggtgattttacaggcataagtgcagttgcagacccaatcggcattatatcg
gaaagggcaggcgaatcagaaaccatgatattctatgatgtaaaaaaggaaagaataaat
gatgtaaggcaaaaaatgccgcttcttgagcagcttaataatttaaggtga

DBGET integrated database retrieval system