KEGG   Picrophilus torridus: PTO0962Help
Entry
PTO0962           CDS       T00177                                 

Definition
(GenBank) hypothetical protein
Organism
pto  Picrophilus torridus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
976952..977677
Genome map
AA seq 241 aa AA seqDB search
MQTLGVKTEEGLRELLTANAEDHMRLMLSAEFMERLGRPEEARELRDKAMVELGHAKAIF
STLVKYQGLDALINEMAKEETEQHVSEYSNVAMNAKSEGHDDIEAMLCKFADQEKGIAET
LNRLGMQKMINEMAKEETEQHVSEYSNVAMNAKSEGHDDIEAMLCKFADQEKGIAETLNR
LGMQKMINEMAKEETEQHVSEYSNVAMNAKSEGHDDIEAMLCKFADQEKGIAETLNKYRN
N
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcagacacttggtgtaaaaacagaagagggtttaagagagctcttaactgccaatgca
gaggaccacatgaggcttatgctatcggcagaattcatggagagacttggcaggccagag
gaggcaagggagctcagggacaaggcaatggtcgagctgggccatgcaaaagcaatattc
tcaacactggtaaagtaccagggacttgatgcactcataaatgaaatggcaaaggaagaa
acagagcagcatgtatcagagtactcaaacgttgcaatgaacgcaaagtccgagggtcat
gacgacatagaggcaatgctctgcaagtttgcagaccaggaaaagggcatagccgaaaca
ttaaacagactcggaatgcagaaaatgatcaatgaaatggcaaaggaagaaacagagcag
catgtatcagagtactcaaacgttgcaatgaacgcaaagtccgagggtcatgacgacata
gaggcaatgctctgcaagtttgcagaccaggaaaagggcatagccgaaacattaaacaga
ctcggaatgcagaaaatgatcaatgaaatggcaaaggaagaaacagagcagcatgtatca
gagtactcaaacgttgcaatgaacgcaaagtccgagggtcatgacgacatagaggcaatg
ctctgcaagtttgcagaccaggaaaagggcatagccgaaacattaaataaatacaggaac
aactaa

DBGET integrated database retrieval system