KEGG   Picrophilus torridus: PTO0986Help
Entry
PTO0986           CDS       T00177                                 

Definition
(GenBank) NAD synthase related protein
  KO
K01916  
NAD+ synthase [EC:6.3.1.5]
Organism
pto  Picrophilus torridus
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PTO0986
Enzymes [BR:pto01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.5  NAD+ synthase
     PTO0986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
996817..997566
Genome map
AA seq 249 aa AA seqDB search
MVERLDGVFKSISDFLRQELNGKNAVIGVSSGIDSALVLTILSKAIDKDRIHAFFMPDRF
TRSADFDDIRSLEGSTGVKINEINIENIVNGYKSTLGINDKKYEGNIRSRVRSVILYYNA
NLLNGLVVGTTNRTEYLIGYFTKYGDGACDLEPIEHLYKSDVRELASYLKVPESIIRKKP
SAGLWGDQYDEDELGMGYEELDSILKDLFEKKTGILDDRYKMVYDMYIRSQHKRKLPKSM
MNDDFRYNV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggtggagagactagatggtgtttttaaaagtatatcagattttctgcgacaggaattg
aatggtaagaacgctgttattggtgtaagctcaggcatagacagtgcacttgtactcaca
atactatcaaaggcaatagataaagatagaatacatgcatttttcatgcctgatagattt
acaaggagtgcagacttcgatgatataagatccctggaaggatctacaggtgtaaagata
aatgaaataaacatagagaacattgttaatggatacaaatcaacccttggaataaacgat
aaaaaatacgagggcaatataagatcaagggtaaggtcagttatattatactacaacgca
aacctgcttaatggccttgttgttggaacaacgaatagaacagagtatttaataggctac
ttcacaaagtacggtgatggtgcatgcgatcttgagccgatagagcatctatacaagagc
gatgtgcgtgagcttgcatcatatctaaaagttcctgaatcaataataaggaagaagcca
tccgcaggtctttggggcgatcagtacgatgaggatgagcttgggatgggctatgaggaa
cttgactcgatattaaaggatcttttcgaaaaaaagaccggaatacttgatgatagatat
aaaatggtttatgacatgtatataagatcacagcataagaggaaacttccaaaatcaatg
atgaacgatgatttcagatataacgtatga

DBGET integrated database retrieval system