KEGG   Picrophilus torridus: PTO0987Help
Entry
PTO0987           CDS       T00177                                 

Definition
(GenBank) Na(+)/H(+) antiporter
Organism
pto  Picrophilus torridus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
997544..998821
Genome map
AA seq 425 aa AA seqDB search
MISDITYEYYQISFILIIAAFAIPLSRKVSIVYIPVLMLFGIVFGPILGFINQSFALFLL
SSFGTVGIGILGLVIILYYESHNINPRIIRRYLYDIAALDTIGMVITAIGAGVIFSLITG
VPFRIGFLFGAIISPTDPASLIPTFRRISMREDVSGTLIGESLFNDPLGIILLDVGIALI
APESSYVSFFTLFSSHIGLILGSVVFMILQMAIPALIGIALGFIIIYLNKYFNFENFIIA
LTLGIVLFEFTSLTAFNITPFPAIIATGAIVGNYSDKSIFWSREMSFNENLSFMAQSIIF
ILLGSILTLREMENYILLGIILSLLVMFLVRPAAVFSSLSIFNFKRELIRFNNKTKTFMS
LVGPRGIVPIVLSTVPYVVGLDDDINILIKYGPLIYVSVSFVVLITIIAQTIYVPLIGKN
LLGRK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgatttcagatataacgtatgagtattaccagataagctttatactgataatagcagcc
tttgcgataccgctttcaaggaaggtttcaatagtttatattccggtgctaatgctcttt
ggtatagtcttcgggcccatccttggctttattaaccaatcatttgcactgtttctttta
tcatcatttggaacagtcggcattggcatacttggcctggtgataatactttactatgaa
tcgcataatataaatccaaggatcataagaagatatttatatgatatagccgcacttgat
accataggcatggttattactgccataggtgcaggtgtgatattctcattaataacaggc
gttcccttcagaataggatttctgtttggtgcaataatatcaccaacagatccggcgtcc
cttataccaacatttagaagaatatccatgcgtgaggacgtttcaggcacattaataggc
gagagcctgttcaatgatccacttggaataatacttcttgatgttggcatagccctaata
gcacctgaatcaagttatgtttcattttttacgcttttttcatcgcatataggtttgatc
cttggttctgttgtgttcatgattctgcagatggccataccggccttaataggcatagcg
ctgggctttataataatatatttaaataaatattttaattttgaaaattttattatagca
ttaacgctgggaatagtgctttttgaattcacatcactcacggcatttaatataacgccg
tttccggcaataatagccaccggtgcaattgtcggaaattactcggacaagagcatattc
tggagcagggagatgagctttaatgaaaatctctcatttatggcccagtccataatattc
atactcttgggaagcatacttacattaagggaaatggaaaattacattttacttggcatt
atattatcattactggtgatgtttctggtaaggccggcagcggttttctcatcattgagc
atattcaatttcaaaagggaattaatcagatttaataataaaacaaagacatttatgtca
cttgttgggccaaggggtatagttccaattgtattatccacggttccatacgttgttggc
cttgatgatgatataaatatattaataaaatacgggccattaatatatgtctcagtatca
tttgtggttcttataacaataatagcacagacgatatacgttccattaatcggcaaaaat
cttcttggaagaaaataa

DBGET integrated database retrieval system