KEGG   Picrophilus torridus: PTO0991Help
Entry
PTO0991           CDS       T00177                                 

Definition
(GenBank) hypothetical membrane protein
Organism
pto  Picrophilus torridus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1000827..1001138)
Genome map
AA seq 103 aa AA seqDB search
MIYPSYLEPYQGYITLVLVFVDGLLFGMVAKKAIVAVVLLVVALIIASFIDLSFIPHISA
ADVISNVTKYASTYASDLHLQSLTITFFLIVFIIGLGIGIWKG
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgatctatccatcatatcttgaaccatatcagggctacataactttggttctggtcttt
gtcgatggcctgttattcggcatggttgcaaaaaaggccattgttgcagttgtcttgctg
gtcgttgcattgattatagcatcatttatagatttatcgtttataccacatataagcgcc
gctgatgtaatatcaaatgtgacaaaatatgcatcaacctatgcctcagatctgcacctg
caatctttaacaataacgttctttttgattgtttttatcataggccttggcataggaata
tggaagggataa

DBGET integrated database retrieval system