KEGG   Picrophilus torridus: PTO0992Help
Entry
PTO0992           CDS       T00177                                 

Definition
(GenBank) hypothetical cardiolipin synthase
Organism
pto  Picrophilus torridus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1001215..1002096
Genome map
AA seq 293 aa AA seqDB search
MIYREPEDTLSPVIDIIRSSKKRLYMNFYLIDDQRILSEIKELVSRGLDVKIIIDGRPCG
DSNAENELENLLKTGAAVKKAPKRFETDSSFDHAKYLFNEKYFMIGTANLTEAAFSRNRE
YIIIEKTRSIRKNLEKIFDADWNDKMAGDFDSIVVSPGSEDAILSFIENSRKILIESEEL
GDDEKILNAMIKKGKKLKIILPDTLSETDYRNSLRLRDAGVRIRYMPKNKIYMHAKMMVS
KYGFIGSQNFTKASLNNNREVGLIFKSYKYKSLLKRTFKKDWKMAEKRPGGRK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgatttatagggaacctgaggatactctatcaccagttatagatataataagatcctcg
aaaaagaggctttacatgaacttttatctaatagatgaccaaaggatactctccgagata
aaagagcttgtttccaggggccttgatgtaaaaatcatcattgatggcaggccatgcggt
gacagcaatgcagaaaacgagcttgaaaatctgttaaagacaggtgctgccgtaaaaaag
gcgccaaaaagatttgaaacggattcatcctttgaccatgcaaagtatctatttaatgag
aaatattttatgataggcacggccaatctcacggaggctgctttttcaagaaaccgtgag
tacataataatagaaaagaccaggtcaataagaaaaaatcttgaaaaaatcttcgatgcg
gactggaatgataaaatggccggtgattttgattccattgttgtctctcctggatcagaa
gatgcaatactatcttttatagagaacagcaggaagatacttatagaaagtgaggagctt
ggagacgatgaaaagattttaaacgcaatgataaaaaagggtaaaaaattaaaaataata
ctgcctgacacactttcagaaacagattacagaaattctttaagattaagggatgccggt
gtcaggataaggtacatgccaaaaaataagatttacatgcatgcaaagatgatggtctca
aagtatggattcataggctcccagaacttcacaaaggccagtctaaacaacaacagggag
gtcggtctcatatttaaaagctataaatacaaatcgctattaaaaaggacttttaaaaag
gactggaaaatggcggaaaaaaggccgggtggcaggaaatga

DBGET integrated database retrieval system