KEGG   Picrophilus torridus: PTO0998Help
Entry
PTO0998           CDS       T00177                                 

Definition
(GenBank) succinate dehydrogenase, subunit D
  KO
K18859  
succinate dehydrogenase / fumarate reductase, subunit D
Organism
pto  Picrophilus torridus
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PTO0998
   00650 Butanoate metabolism
    PTO0998
  Energy metabolism
   00190 Oxidative phosphorylation
    PTO0998
   00720 Carbon fixation pathways in prokaryotes
    PTO0998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1007369..1007698
Genome map
AA seq 109 aa AA seqDB search
MKIDGAELGEEKPVSERPGGKPFAREIDYRVGDLFWGKIHIRNSGKMYMLVTSKIPFNWK
PLVKDLKLKGKVVDSAGGFLWVQEDEKYINDDVKFLKDYLEKMKNSKKE
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagatggagccgagcttggcgaggagaagcccgtatctgaaagaccgggcggg
aagccatttgcaagggaaatcgattaccgcgttggggacctcttctggggaaagatacat
ataagaaacagcggtaagatgtacatgctcgtcacatccaagataccatttaactggaag
ccgctggtcaaggatttaaaattaaagggaaaggttgttgattccgcaggtggctttctc
tgggttcaggaagatgaaaaatatataaatgacgatgtaaaatttttaaaggattattta
gaaaagatgaaaaatagtaaaaaggaataa

DBGET integrated database retrieval system