KEGG   Picrophilus torridus: PTO1002Help
Entry
PTO1002           CDS       T00177                                 

Definition
(GenBank) succinyl-CoA synthetase alpha chain
  KO
K01902  
succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
pto  Picrophilus torridus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PTO1002
   00640 Propanoate metabolism
    PTO1002
   00660 C5-Branched dibasic acid metabolism
    PTO1002
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PTO1002
Enzymes [BR:pto01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PTO1002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1011028..1011882)
Genome map
AA seq 284 aa AA seqDB search
MVLINRNTRVIIQGITGHQGSFHSGEMLKFGTNIVAGVSPGKGGSKINNIPVYDTIDEVM
DLKPDATMISVPAPFVKDAALEAIDHGIKFIYILTEHVPVQDTMEIVNQAKRKNIFMIGP
NGPGITVVGESKIGIMPNNIFRKGRVAVASRSGTLTYEIVNAITQAGLGESTVIGLGGDP
IVGTTFTEVVRIFNEDPETDMIVMVGEIGGSEEERAASYVKEHVKKKVVGYITGRSAPPG
KRMGHAGAIIEKGAGTAESKIRAFESAGIKVAEYPYQIPDLLKQ
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggtattaataaacaggaatacaagggtaattatacagggaataacaggccaccaggga
tctttccattccggcgagatgctaaaatttggaacaaacatcgttgcaggggtttcacca
ggaaagggtggctcaaaaattaataatatcccggtctatgatacaattgatgaggtaatg
gatctaaagcctgatgcaacaatgatatctgttccggcaccgtttgttaaggatgcagca
cttgaggcaatagatcatggaataaaatttatatatatattaacggaacatgtgccagtc
caggatacaatggagattgtaaaccaggccaaaaggaagaacatattcatgataggccca
aacggtcctggaataacagtcgttggtgaatcaaagataggcataatgccaaacaatata
ttcagaaagggcagggttgctgttgcatcgagaagcggaacattaacctatgagattgta
aatgcaataacacaggccggccttggtgagagcaccgtcataggtcttggcggcgatcca
atagttggcacaacatttacagaggtcgtaaggatatttaatgaggatcctgagacagat
atgatcgtcatggttggcgagatcggtggcagcgaggaggagcgcgcggcatcttatgta
aaggagcatgtaaaaaagaaggttgttggatacataaccggaaggagtgcaccaccagga
aaaagaatgggccatgctggcgcaattatagagaagggtgcaggtacagcagagtcaaag
ataagggcatttgagtccgcgggtataaaggtcgcagagtatccataccagataccggat
ctattaaaacaatga

DBGET integrated database retrieval system