KEGG   Picrophilus torridus: PTO1003Help
Entry
PTO1003           CDS       T00177                                 

Definition
(GenBank) succinyl-CoA synthetase beta chain (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pto  Picrophilus torridus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PTO1003
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PTO1003
   00640 Propanoate metabolism
    PTO1003
   00660 C5-Branched dibasic acid metabolism
    PTO1003
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PTO1003
Enzymes [BR:pto01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PTO1003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1011883..1012989)
Genome map
AA seq 368 aa AA seqDB search
MNLYEYMGKEIFRNYGIPVPDGYTIEKTDEIRDVSYPVAIKSQILIGKRGKAGGIKFADN
KNDAVKYASELLGSKINGMTVTKLLIEKKLDIKKELYLSITMDRTNRAPVIIASTEGGMD
IEEVPDDKIVKRVIDPLIGYSQYIGREIVSSMKLDADLSKSFLEILERLYRVFMGEDALL
VEINPLVIDGNKNIIAADSKIVLDDNALFRHKEINIRDPEKTELEIESQSKSFTFIEMDG
DIGVIANGAGLTMATLDALTLHNLKPRNFLDLGGTDSIDIVKDAFSFVMKADPDIIFVNI
FGGVTKADTVANGIVASKKEFNITKPIVVRLSGIHEDEGRRILKDNGINAFSNMNDAILD
IVKIKEGK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaatctttatgaatacatgggcaaggaaatatttagaaactatggaataccggtacct
gatggatacacaatagaaaaaacagatgaaataagggatgtatcctaccctgtggcaatc
aaatcgcagatattaataggaaagcgtggcaaggcaggcggcataaaatttgccgataat
aaaaacgatgctgttaaatatgcctcagagctccttggttcaaagataaacggcatgact
gtgacaaagcttcttatagaaaaaaagctcgatattaaaaaggagctttaccttagtata
acaatggatagaacaaacagggctcctgtaataatagcatccacggagggtggcatggat
atagaggaagtccctgacgataagattgtaaagagggtaatagatccattaataggttat
tcacaatacataggcagggagatagtaagctcgatgaagcttgacgcggatctttcaaag
agctttcttgaaatacttgaaaggctttacagggtcttcatgggcgaggatgcactcctc
gttgagataaacccgctggttatagatggtaataaaaatataatagcagctgattccaag
attgtccttgacgataacgcacttttcaggcacaaggagataaacataagagaccctgag
aagactgagcttgaaatagagtcacagtcaaagagctttacatttattgagatggatggc
gacattggcgttatagcaaatggtgccggactaaccatggcaactttagatgcattaaca
ctgcacaaccttaagccgaggaatttccttgaccttggtggaacagacagcattgatata
gtaaaggatgcattttcctttgtaatgaaggctgatccggacataatctttgttaacatc
ttcggtggtgttacaaaggcagataccgttgcaaatggtatagttgcctcaaaaaaggaa
tttaacataacaaagccaatagttgtaaggttaagcggaatccatgaggatgaggggaga
agaatattaaaggataacggcataaatgcgttttcaaacatgaacgatgctatactagac
atcgttaaaataaaggaggggaaatag

DBGET integrated database retrieval system