KEGG   Picrophilus torridus: PTO1005Help
Entry
PTO1005           CDS       T00177                                 

Definition
(GenBank) hypothetical protein
Organism
pto  Picrophilus torridus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1014427..1014642
Genome map
AA seq 71 aa AA seqDB search
MNAILKFILLALPYFFMVLGVGIYMRVKPELFGIPFFYWYQLVWIFLAAILTYTVYAIES
HERRGLNVHRP
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccatactgaagtttatacttctggccctgccatacttttttatggttctgggc
gtgggtatttacatgcgggttaagcctgagctttttgggataccgttcttttactggtat
cagctggtctggatctttcttgctgcaatactgacatacacggtctatgcaatagagtcg
cacgaaaggaggggcttaaatgttcacagaccttga

DBGET integrated database retrieval system