KEGG   Picrophilus torridus: PTO1008Help
Entry
PTO1008           CDS       T00177                                 

Definition
(GenBank) hypothetical prefoldin beta subunit
  KO
K04798  
prefoldin beta subunit
Organism
pto  Picrophilus torridus
Brite
Chaperones and folding catalysts [BR:pto03110]
 Heat shock proteins
  GimC
   PTO1008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1016386..1016757
Genome map
AA seq 123 aa AA seqDB search
MVEPNLSAYIQNQIKQAQDIEAQIESIASQRYQLDVLIRELDKTIKELKSISEGTPVYKS
VGPVMYLVEDKNKLINDLEEQKELSQMRSKTLENQQKSLEQKYREVQESLQKKYQEASKG
EGN
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
ttggtagagccaaatttaagtgcatatatacagaaccagataaagcaggcacaggacata
gaggcacagatagagagcatagcctctcagaggtaccagctcgatgtccttataagggag
cttgacaagaccataaaggaattaaagtcaatttctgaaggaacacctgtttataaaagt
gttggacccgttatgtaccttgttgaggataaaaataaacttataaatgatcttgaggaa
cagaaggaacttagccagatgaggagcaagaccctagaaaaccagcaaaaatcacttgaa
caaaagtaccgcgaggtgcaggaatcattacaaaaaaagtatcaggaagccagcaagggt
gaaggtaattga

DBGET integrated database retrieval system