KEGG   Picrophilus torridus: PTO1009Help
Entry
PTO1009           CDS       T00177                                 

Definition
(GenBank) hypothetical conserved protein DUF198
  KO
K17488  
GTP cyclohydrolase IV [EC:3.5.4.39]
Organism
pto  Picrophilus torridus
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PTO1009
Enzymes [BR:pto01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.39  GTP cyclohydrolase IV
     PTO1009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1016754..1017575
Genome map
AA seq 273 aa AA seqDB search
MIELKDVQGFRPDYEIPIKRAGIKSFKRRVKLNYNNESFDSYVDVSISVSLNPDRKGLDM
SRTIESVRSSYNLNDVAYDIYNDLFSRINYSSSGYVNVSFDFYYNNKIYPVSLIAEGDKN
DVKRYVEVSAEGMTVCPCAMETIRSIMLYDYNVSYGDIGISHNQRNKASLKIQYIKDAHL
ERLIDILESSFSYPVRNMLKRYDEGKMIIEAHKRPKFVEDVVREIAYKAAFMEPEMNLYM
DVRSESFESIHPHNAYAEIEDYTANIRSYLKNR
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
ttgatagagcttaaggatgtccaggggtttagacctgattatgagataccaataaaaagg
gccggtataaaatcatttaaaaggcgtgttaaattaaattataataacgagtcatttgac
tcatatgtggatgtatcaatatctgtttcattgaatcctgacaggaagggcctggacatg
tcaagaactattgaatcagtaagatcttcatataatttaaatgacgttgcatacgatata
tacaatgatctattttcaagaataaattattccagcagcggttatgttaatgtttcattt
gacttttattataataacaagatctatccagtttcattaattgccgagggcgataaaaat
gatgttaaaagatatgttgaggtctccgccgagggtatgaccgtatgcccatgtgccatg
gaaacaataagatcaataatgctctatgactataatgtatcatacggtgatataggcata
tcacataaccagagaaataaagcttcattgaaaattcagtacattaaggatgcgcatctt
gagagattaatagatatacttgagtcatctttttcatatcctgtaaggaacatgctaaag
cgctatgacgagggtaagatgataatagaggcccacaaaaggccaaaatttgttgaggac
gttgtcagggagatagcctacaaggcagcctttatggagcctgaaatgaacctttacatg
gatgtaagatctgaaagctttgagagcatacatccacacaatgcatacgcggaaatagag
gattacacagccaatataaggtcatatttaaaaaatcgttaa

DBGET integrated database retrieval system