KEGG   Picrophilus torridus: PTO1010Help
Entry
PTO1010           CDS       T00177                                 

Definition
(GenBank) glycerol-3-phosphate cytidylyltransferase
  KO
K14656  
FAD synthetase [EC:2.7.7.2]
Organism
pto  Picrophilus torridus
Pathway
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    PTO1010
Enzymes [BR:pto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.2  FAD synthetase
     PTO1010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1017572..1017991)
Genome map
AA seq 139 aa AA seqDB search
MKIMATGVFDILHPGHIHYLSESKKLGDYLIVIIATDKTAGSHGKKLIFNEEQRRFMVSQ
LRMVDEAIIGHEDDIFKTVYEVRPDIITLGYDQHFNDSEIEKKCRDLGLNTRVVRISKYD
GEIKSSSDIRRRIIELYNR
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcatggccacaggagtctttgatatattgcatccgggtcacatacattattta
tcagagtcaaaaaagcttggtgactatttaatagttataatagccacggataaaacggca
ggcagccatggaaaaaagcttattttcaatgaagagcagaggagatttatggtgtcgcag
ctaaggatggtcgacgaggcgataatcggccatgaggatgatatttttaaaactgtatac
gaggtaaggcctgatataataacacttggctatgatcagcactttaatgattctgagata
gaaaaaaaatgcagggaccttggattaaacaccagggtcgtaagaatatcaaaatatgat
ggtgagataaaaagctcatctgatataagaaggagaattatcgagctttataatcgttaa

DBGET integrated database retrieval system