KEGG   Picrophilus torridus: PTO1017Help
Entry
PTO1017           CDS       T00177                                 

Definition
(GenBank) transposase
Organism
pto  Picrophilus torridus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1022679..1023152)
Genome map
AA seq 157 aa AA seqDB search
MTKYDELLQNMTFYSLESVNNRIKYHERELKRLKFIKLILSGVSVNNASSICGFSRQYGY
KIIKNCIENNKSKKGRHCKLNSSQMEILINYLNEKMPFSIIDVKCFLEDQNIKYCEKQIR
RIINSLGFRYCRLLKGYINVYAHKKLIENIDDKISLK
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaatatgatgaattacttcaaaatatgactttttattcattagaatccgttaat
aaccggataaaataccatgaaagggaactaaaacgcctaaaattcataaagttaatatta
tcaggtgtaagcgttaataatgcatcgagtatttgcggcttttcaaggcagtatggttat
aaaatcatcaaaaactgcattgaaaataacaaatcaaaaaaagggaggcactgtaaacta
aatagttcccaaatggaaatattaataaattacctcaatgaaaaaatgccattttctatt
atagatgttaagtgctttttagaggaccagaatataaaatactgtgaaaaacagataagg
aggataataaacagtctcggttttaggtactgcaggcttttaaagggttatataaatgtt
tatgcccacaaaaaattgattgaaaacatcgatgataaaatcagtttaaaatga

DBGET integrated database retrieval system