KEGG   Picrophilus torridus: PTO1025Help
Entry
PTO1025           CDS       T00177                                 

Definition
(GenBank) acyl-CoA dehydrogenase, short-chain specific
Organism
pto  Picrophilus torridus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1033146..1034090
Genome map
AA seq 314 aa AA seqDB search
MEDEINIIRDNIKEFSSKNLDEKEIEANGLNNMLEKLSAQGIINGTIESKYGGLELDKKT
GMAIIEEVSKYSPSAAFYSYITGIYIKAVSGSEIEDTSNDIAAGKKTASISFSYKNNDNK
IYDVFFLSNENALAVIDNDLYYVSGKYEIRDSLGFKGLKFGDMEIEKKTKIGESESFFNA
VRFMDPELCSMSLGLMYGSIEKAFEYSKIRSLFNTKIKDFGPVAYTISDIMSRLEIARHY
LYSNGKIEFAKNFISSMLVDVTRTAVNIHGGYGFFVDFGIEKYYRDAVTLKSMLFMNIKN
ELSNYVYGDKAGFI
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggaggacgagattaatataatacgtgacaatattaaggaattctcatcaaaaaatctt
gatgaaaaggaaatagaggcaaatggattaaataatatgcttgaaaaactatcggcccag
ggtataataaatggcacaattgaatcaaagtacggtggcctggagcttgataaaaaaact
ggcatggccataatagaggaggtttcaaagtactcgccatctgcggcattttattcatat
attactggaatatacataaaggctgtttcaggttctgaaatagaggatacatcaaatgac
atagcagcaggcaaaaaaaccgcatcaataagcttttcatacaaaaataatgataataaa
atatacgatgtttttttcttaagcaatgaaaatgcacttgccgttatcgataatgactta
tattacgtttcaggtaaatatgaaataagggattcccttggatttaaaggcctgaaattc
ggggatatggaaatagagaaaaaaacaaaaataggcgaatcagaatcattttttaacgca
gttagattcatggatcctgagctttgctcgatgtctcttggtttaatgtatggctccata
gaaaaggcctttgaatactcaaagatcagatcactatttaacacaaagataaaggacttt
ggccctgttgcatatacgatctcagatataatgagcaggcttgaaattgcaaggcactat
ctatacagcaatggaaagattgagtttgcaaagaattttatatcatcaatgctggttgac
gttacaagaactgcagtaaacatacacggcggttatggattctttgttgatttcggcatt
gaaaagtactacagggatgctgtaacactgaaatcaatgttatttatgaacataaaaaac
gagctttcaaattatgtttatggggataaagccggctttatataa

DBGET integrated database retrieval system