KEGG   Picrophilus torridus: PTO1037Help
Entry
PTO1037           CDS       T00177                                 

Definition
(GenBank) formate dehydrogenase subunit D
  KO
K02379  
FdhD protein
Organism
pto  Picrophilus torridus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1046582..1047370)
Genome map
AA seq 262 aa AA seqDB search
MMPYISKNAVIIGRDRKFITDNVTVEEPLQISIENENRIYNVSVIMRTPVDDEALATGFL
VNEGIIEPDKIIKVSKRSENNVCVSVESFNEDLLKNRNFYVNSSCGVCGKTDIENVFIKS
HGIVRSQSRTDHSIILGLPDKMMKNQKIFSYTGGIHAAALFDLNGNMISISEDIGRHNAV
DKTIGKMILKNVYRMEDSILQVSGRAGFEILQKASMFGVSIVSSVSAPSSLAIDVAETFN
ITLISFVRKNRMNIYSHPERIL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgatgccatatatatcaaaaaatgctgttataataggcagggacaggaaattcatcaca
gataatgttacggtggaagagccattgcagatctcaatagagaatgagaacagaatttat
aatgtatcggttatcatgagaacacctgttgatgatgaggcccttgccacaggcttcctt
gtaaacgagggaataatcgaacctgataaaataattaaggtatcaaagagatcagaaaac
aatgtttgtgtttcagttgaatcatttaatgaggatttattaaaaaacaggaatttctat
gtaaattcaagctgtggtgtatgtggaaaaacagatatagaaaacgtgtttataaagagc
catggaattgttagatcacaatcaaggacggatcacagcattatactgggtcttccggat
aagatgatgaaaaatcagaaaatattttcatacaccgggggcattcacgctgcggccctg
tttgatctcaatggaaatatgatatcaataagcgaggacataggcaggcataacgcggtt
gataaaaccataggaaaaatgattttgaaaaatgtatatcgtatggaggattcaatatta
caggtaagcggcagggctggctttgagatacttcaaaaagcctcaatgttcggtgtatcc
atagtaagctctgtatctgcaccatcatcccttgcaatagacgttgcagaaacatttaac
attacattaatatcatttgtaagaaaaaatagaatgaatatatattcacatcctgaaagg
atactataa

DBGET integrated database retrieval system