KEGG   Picrophilus torridus: PTO1040Help
Entry
PTO1040           CDS       T00177                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pto  Picrophilus torridus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PTO1040
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PTO1040
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PTO1040
Enzymes [BR:pto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PTO1040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1050811..1051959
Genome map
AA seq 382 aa AA seqDB search
MSVLKCPVCGNEYDINRSNYLCDKCGNILEVIHENDFVKENFRGVWRYKSIIHPGIDKRL
IVTRGEGNTFVYGHENISSYSGIKNIKLKHEGENPTGSFKDRGMTVAVSEAMRLGYKKTL
CASTGNTSASAASYSAMAGIENFVLIPDGKIAVNKLAQAYVYGSKIIKVPGNFDDAMGKL
MNIISKNNNFYVLNSINPWRVEGQKTIAFEILEENEPDFIALPAGNLGNTTAIGKAIKEF
HDLGLIKKIPRIVSVQAEGASPFYNLVNNHEGSLNPVNPETIASAIRIGNPVNWKKALKY
IKFTKGIVEKVTDDEILNAKRIIDRSGIGCETASAASLAGVKKLSDAGIIDRNDEVFCIL
TGNVLKDIHIENINSMDINILS
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtcttaaaatgcccggtatgcgggaacgaatatgatataaacagaagcaattat
ctctgcgataaatgcggaaacatacttgaggtaattcatgaaaatgattttgtaaaagaa
aattttaggggtgtctggaggtacaaaagcattatacatccgggcatagataaaaggcta
attgttacaaggggtgagggcaatacctttgtgtacggtcatgaaaatatatcatcatat
tcaggaataaaaaatataaaactgaagcatgagggtgaaaatccaacaggttcatttaag
gatcgtggcatgacagttgcagtatccgaggccatgaggctcggatataaaaagacccta
tgcgcatcaaccggaaatacatccgcatctgctgcaagctattctgcaatggcaggcatt
gaaaacttcgtcctgataccagatggtaaaatagcggtaaacaagcttgcccaggcctac
gtttatggttcaaaaataataaaggttcctggcaatttcgacgatgcaatggggaagcta
atgaacataatatctaaaaataataatttttatgttttaaattcaataaatccctggcgt
gttgagggtcaaaaaaccattgcctttgagatacttgaggaaaatgagccggactttata
gcactacctgcaggaaaccttggaaacacaacggcaataggcaaggcaataaaggaattt
catgatcttggtttaataaaaaagataccaagaatcgtttcagttcaggccgagggcgca
agcccattctataaccttgtcaataaccatgagggcagtcttaatccggtaaatcctgaa
acaattgcatcggcaataagaataggaaaccctgtcaactggaaaaaggcattaaaatac
ataaaattcacaaaaggtatagtcgagaaggttacagatgacgagatactaaatgcaaaa
agaattatagacagatccggaataggctgtgaaacggcctctgccgcatcacttgcaggt
gtaaaaaagctctcagatgcaggtataatagacagaaacgatgaggttttttgtatatta
accggaaacgttttaaaggatatacatatagaaaatataaattccatggatattaatatt
ttatcttaa

DBGET integrated database retrieval system