KEGG   Picrophilus torridus: PTO1040Help
Entry
PTO1040           CDS       T00177                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pto  Picrophilus torridus
Pathway
pto00260  Glycine, serine and threonine metabolism
pto00750  Vitamin B6 metabolism
pto01100  Metabolic pathways
pto01110  Biosynthesis of secondary metabolites
pto01120  Microbial metabolism in diverse environments
pto01230  Biosynthesis of amino acids
Module
pto_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PTO1040
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PTO1040
Enzymes [BR:pto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PTO1040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP TF_Zn_Ribbon Desulfoferrod_N HypA zinc_ribbon_2 A2L_zn_ribbon zinc-ribbons_6 C1_2 DZR Zn_ribbon_SprT
Motif
Other DBs
NCBI-ProteinID: AAT43625
UniProt: Q6L077
Position
1050811..1051959
Genome map
AA seq 382 aa AA seqDB search
MSVLKCPVCGNEYDINRSNYLCDKCGNILEVIHENDFVKENFRGVWRYKSIIHPGIDKRL
IVTRGEGNTFVYGHENISSYSGIKNIKLKHEGENPTGSFKDRGMTVAVSEAMRLGYKKTL
CASTGNTSASAASYSAMAGIENFVLIPDGKIAVNKLAQAYVYGSKIIKVPGNFDDAMGKL
MNIISKNNNFYVLNSINPWRVEGQKTIAFEILEENEPDFIALPAGNLGNTTAIGKAIKEF
HDLGLIKKIPRIVSVQAEGASPFYNLVNNHEGSLNPVNPETIASAIRIGNPVNWKKALKY
IKFTKGIVEKVTDDEILNAKRIIDRSGIGCETASAASLAGVKKLSDAGIIDRNDEVFCIL
TGNVLKDIHIENINSMDINILS
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtcttaaaatgcccggtatgcgggaacgaatatgatataaacagaagcaattat
ctctgcgataaatgcggaaacatacttgaggtaattcatgaaaatgattttgtaaaagaa
aattttaggggtgtctggaggtacaaaagcattatacatccgggcatagataaaaggcta
attgttacaaggggtgagggcaatacctttgtgtacggtcatgaaaatatatcatcatat
tcaggaataaaaaatataaaactgaagcatgagggtgaaaatccaacaggttcatttaag
gatcgtggcatgacagttgcagtatccgaggccatgaggctcggatataaaaagacccta
tgcgcatcaaccggaaatacatccgcatctgctgcaagctattctgcaatggcaggcatt
gaaaacttcgtcctgataccagatggtaaaatagcggtaaacaagcttgcccaggcctac
gtttatggttcaaaaataataaaggttcctggcaatttcgacgatgcaatggggaagcta
atgaacataatatctaaaaataataatttttatgttttaaattcaataaatccctggcgt
gttgagggtcaaaaaaccattgcctttgagatacttgaggaaaatgagccggactttata
gcactacctgcaggaaaccttggaaacacaacggcaataggcaaggcaataaaggaattt
catgatcttggtttaataaaaaagataccaagaatcgtttcagttcaggccgagggcgca
agcccattctataaccttgtcaataaccatgagggcagtcttaatccggtaaatcctgaa
acaattgcatcggcaataagaataggaaaccctgtcaactggaaaaaggcattaaaatac
ataaaattcacaaaaggtatagtcgagaaggttacagatgacgagatactaaatgcaaaa
agaattatagacagatccggaataggctgtgaaacggcctctgccgcatcacttgcaggt
gtaaaaaagctctcagatgcaggtataatagacagaaacgatgaggttttttgtatatta
accggaaacgttttaaaggatatacatatagaaaatataaattccatggatattaatatt
ttatcttaa

DBGET integrated database retrieval system