KEGG   Picrophilus torridus: PTO1045Help
Entry
PTO1045           CDS       T00177                                 

Definition
(GenBank) (S)-2-hydroxy-acid oxidase chain D
  KO
K00104  
glycolate oxidase [EC:1.1.3.15]
Organism
pto  Picrophilus torridus
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PTO1045
Enzymes [BR:pto01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.15  (S)-2-hydroxy-acid oxidase
     PTO1045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1054990..1056384
Genome map
AA seq 464 aa AA seqDB search
MDIYNDLSRIIDPRIILNKTEEKIPFKNDASYISGSEPYLIVMPENVNDVSKVLKYCNDN
NINVVPRSGGTSLTGSSVVYHDGIVIDMLKMNKIKNLSLEDRYVVAEPGVRLDDLNIYLS
KYNFFYPPDPASSLAATVGGTLSTNAGGLRAVRYGTTKEWVLGLEIVLPDGSIIRTGEYT
LKRSAGYDLTALFLGSEGTLGIITSAVLKIAPLPEKVSRIMAFFKTIDDVGIAVSRIKKS
GITPLISEFLDRTSMEAVKNSVNLNIPENMNYMLILDIDSDLESIDRKSGDAIKIIKEIT
DKIEVTTDKKRMDEIYRARKGLYSSLLLNRENDRQIVVIGDVVFPASELPGALHEAENLI
KKYNLKVPLFGHIGDGNLHANIITDADEKSLEKVHRFQIELADIAIKHNGSVSAEHGIGL
EKNDLLYKEYRDRNNLKALELMREIKNTIDKNNIMNRGKIFYET
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggatatttacaatgatctttcaagaataatagatccaagaataatattaaacaaaact
gaagaaaaaattccgtttaaaaacgatgcatcatatatatcaggaagcgagccatatcta
atagtcatgcctgaaaatgtcaatgatgtatcaaaggttttaaaatattgcaatgataat
aatataaatgttgtgccaagatccggcggtacatctctaacaggttcaagtgtggtttac
catgacggaatagtcattgatatgttaaaaatgaacaaaataaaaaatctaagccttgag
gatagatacgtcgttgccgagccaggtgtaaggctcgatgatcttaatatttatctatca
aaatacaattttttttatccgccagaccctgcaagctcactggcagcaactgttggtggt
acattatcaacgaatgctggcggcctcagggccgtacgctatgggacaacaaaggaatgg
gttctcggacttgaaatagtattaccggatggtagcataataagaaccggtgagtacaca
ttaaagaggagtgcaggttatgatctgacagcattattccttggctctgagggcactctt
gggataataacatctgctgtattaaaaatagccccgctcccggagaaggtctcaaggata
atggccttttttaaaaccatagacgatgtcggcattgcagtatcaagaataaagaaaagc
ggcataacaccgttgatctctgaattcctggacaggacaagcatggaggccgttaaaaat
tcggtaaatttaaatatacctgaaaacatgaattacatgcttattctagatatagattct
gatcttgaatccattgacaggaaatcaggcgatgcaataaaaataataaaagaaataaca
gataaaatagaggttacaacagataaaaagagaatggatgaaatatacagggcaagaaag
ggtttatactcatcactgctgcttaacagggaaaacgacaggcagatcgttgtgatcggg
gatgttgtattccctgcttcagagcttccaggggcgcttcacgaggcagagaacctgatt
aaaaaatataatttgaaagtgccattattcgggcatatcggtgatggaaacctgcatgca
aatattataacagatgccgacgaaaaatctcttgaaaaagtgcatagattccagattgag
cttgcggatatagcaataaagcacaacggttcagtttctgcagagcacggtatcggcctt
gaaaagaacgatcttttatataaagaatacagggatagaaataatttaaaagccctggaa
ctcatgcgtgagattaaaaatacaattgataaaaataatataatgaacaggggtaagata
ttctatgaaacctga

DBGET integrated database retrieval system