KEGG   Picrophilus torridus: PTO1047Help
Entry
PTO1047           CDS       T00177                                 

Definition
(GenBank) glutamine-hydrolyzing asparagine synthase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pto  Picrophilus torridus
Pathway
pto00250  Alanine, aspartate and glutamate metabolism
pto01100  Metabolic pathways
pto01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PTO1047
Enzymes [BR:pto01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PTO1047
Peptidases [BR:pto01002]
 Cysteine Peptidases
  Family C44
   PTO1047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase NAD_synthase
Motif
Other DBs
NCBI-ProteinID: AAT43632
UniProt: Q6L070
Position
1057598..1058305
Genome map
AA seq 235 aa AA seqDB search
MIEEAVYNALKEEIEKVRSKKCAISYSGGLDSTLLLYISNFSFNPYTTGYSNSRDIKNAE
ETSRILNFNVNKIILDNVNINSYLNDLIKIDKNIKKSEIGYELVLFITLDYISEKYVVTG
QGADEIFFGYRRFIDDDNLGNEHYIKKLIEVTLPRERKIADYYNKELITPYLSDGIMDLR
NDITKDKNIINGVNKMILRNIAKNIGLPEEVYLKNKKAAQYGSGISNALKKVMNK
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgatagaggaagccgtttataatgcacttaaagaggaaatagagaaggttagatcaaag
aaatgtgccatatcatattccggtggccttgacagcacgcttcttctttacatatcaaac
ttttcatttaatccctatacaacgggatattcaaactcgagggacataaaaaatgcggag
gaaacatcaaggattctaaattttaatgtgaataaaatcatacttgacaatgtaaacata
aacagctacctgaatgatttaattaagatcgataaaaacataaagaaatctgagattggc
tatgaactggttctttttataaccttagattatatatccgaaaaatacgttgtaaccggt
cagggggctgatgagattttctttggatacaggcgctttatagacgatgataaccttgga
aacgagcattatataaaaaaattaatcgaggtaactcttccaagggaaagaaagattgcc
gattattataataaagaactgataacaccatatttatcagatggcatcatggatcttaga
aacgatattaccaaggataaaaatataataaacggtgtaaataaaatgatcctaaggaac
atagcaaagaacattggcctgcctgaagaggtataccttaaaaacaaaaaggcagcgcag
tacgggtcaggcataagcaatgcattaaaaaaggttatgaacaaataa

DBGET integrated database retrieval system