KEGG   Picrophilus torridus: PTO1050Help
Entry
PTO1050           CDS       T00177                                 

Definition
(GenBank) subtilase family protein
Organism
pto  Picrophilus torridus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro-kuma_activ AAA_13 Reo_sigmaC TcfC TBPIP HOOK WEMBL DUF872 Fez1 Golgin_A5 FPP Spc7 FAM76
Motif
Other DBs
NCBI-ProteinID: AAT43635
UniProt: Q6L067
Position
1060213..1064373
Genome map
AA seq 1386 aa AA seqDB search
MKNSYKKIAAYSMVAIFIASLFFVGASIGHVQSAPGRDNAMVTVQKPVITGNTKTFGNFE
LINEESKMNLNATVTVTLSFKNSLSSYINEISNPSSPFYRNYMNVDEIGSEFGLSQSTYN
MIASYFSNYNIKVYKSPARLTMSLSGTVSQFDKAFNTKIGAFAIEYKSKGMWIPLFGSNS
GLNGNVSVSPLIYVNTGDLSLPEYISQYIGGISGLDGAMAAPALVMPFNMTPKSGVQPSI
TGNGSYNNPYTLSQIQNITYANYTWALNSETPTDAASENPSGGYQFLFPSTMHVLTGASN
LWSGKTTIDSEPDLGQGITVAVIEVGDLPMSWLQEFAKQVWNNSNQVTSRLSVINLLGAN
LFDGYIYGWTLETALDIEYIAAMAPDAHIDLVAVPNPDFSSFDYAYQYIADHLTSGNNAT
DSVTITSNSYGADEITTALKGAPMYITVEDTLLSELNAVGVTNFFASGDYGSYASLCEYG
ATSAGMPAIATGSTSVGGGQLTAESNGIEFPDTGVYALSTLYNIEMQVAPATGVASFTYW
SYGLGFGGTYKGYVGGGFGQSAMLSQPWWQNALDTYSSGARMDPVISGSAAFNMSVYTGI
WNIFYGGTSFATPISAGEWALIEEQAKMAYGTAAMGDINPLLYGAHNAYEAHVTAFYNNP
FIDMENIGRGFNYGPVNSFDWYYFNLSINEPSDPVVPWWTFTINGPEGNGWSYLQGLGMI
KVNTMDLELIGQLPTIDHSLLNEPFKVLMVTPSGLEPFTYLQGGKTYTFKILLSDGQPGS
YYTVEAYSGGADNGVYGGGNITMITTNSNGMFNYTPVYNYSSPSMSASEYGYFYVTTPAS
SYWSFSQFAVKAKNETGNLTLGVTNALGDLSYNVAEVPMFTDTMTGYYNYFGATGIVELN
GMPVSGAVVHEVSLNNSEFSAEDSGLPVSSYAPGVQIGTFLSDGRGMFNYWTDSALAEFN
GPLYTQVEELYATYGNLTSNKVIVYIEPQAGNFYPDLHIVSGKYLVGNVEFSDMKYVNFV
NISIGSAPGEYKNVTFAPEFYDYVPELYFVNGYYITVYKKVPVSGIFNGIIPVNLTIPSG
KLDLRMVASGYNDLSFEYSFFGFVFSIQDIQSPIVWSDPYIIFNAGTLPHLDISGPSGMV
SGNITLNYNASSNENISSSVIEIAYAGGYRILRSDAGLSGSININTLNLPDGYYMINYIV
TTNTGLTSKASDLIYIDNTAEKLQAELNNIMAEYNSTVSELKQLQSRLTSEKNLNSNLTL
KISELNNNLSLMKLDLVSMESRYNATYTELESAQANLTKYIELNASNTVTINNLENEISD
YKANITMEKNTISSLESKISSMQAEIYKMRHPTVTSIINDIGGYTTLIIIGLMAVVIGLI
IAYRKK
NT seq 4161 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattcgtataaaaagattgcggcatactcgatggtggcaatctttatagcctcg
ttattttttgttggggccagcatcgggcatgtccagagtgcacctggcagggataatgcc
atggtgacagtgcagaaaccggtgataaccggaaacacaaagacatttggtaactttgag
ctgataaacgaagagtcaaagatgaatttaaacgcaactgttacagttacattgagcttt
aaaaactcattaagcagctatataaatgagatatcaaacccatcatcgccgttttacaga
aactatatgaatgtagacgaaataggcagcgaattcggtttatcgcagtcaacatacaac
atgatagcatcgtacttttcaaattataatataaaggtctataaaagccctgcaagatta
acaatgagtctatcaggcacggtttcacagttcgataaggcctttaacacaaaaataggc
gcatttgcaatagaatacaaaagcaagggcatgtggatcccgttattcggcagcaacagc
ggtttaaatggcaatgtatcggtatctccattgatatatgttaacaccggtgatttaagc
ctgcctgaatacatatcacagtatataggcggaatatcaggtctggatggtgcaatggca
gcaccggcccttgttatgcctttcaacatgacgcccaagtcaggcgttcagccatcaatt
accggcaatggatcatacaataatccatacacgttatcacagatacagaatataacatat
gcaaattacacatgggcattaaacagtgaaacaccaacagatgctgcatctgagaaccca
tcaggcgggtaccagtttctgttcccaagtacaatgcacgttctaacaggtgcatcaaat
ctgtggtcaggcaaaacaacaattgacagcgaaccagatctcggtcagggaataacagtt
gcagttatcgaggtcggtgatcttccaatgtcatggctccaggaatttgcaaagcaggtc
tggaacaattcaaaccaggtaacatcaaggttaagcgttataaaccttcttggtgcaaac
ctcttcgatggttatatatatggctggacgcttgaaacggcccttgatatagagtacata
gccgcaatggctccagatgcacacatagatcttgttgccgtgccgaatcctgatttttcg
tcctttgattatgcataccagtacatagcagatcatttaacatctggaaacaatgcaacg
gactctgttacaataaccagcaactcatacggtgctgatgaaataacaacagcgcttaag
ggtgcgccaatgtacataacagttgaggatacattattatcagaattaaatgcagtcggc
gttacaaacttctttgcctccggcgattatggctcatatgcatcattatgcgagtacggt
gcaacaagcgcaggaatgccggcaatagcaacaggatcaacaagtgttggtggaggccag
ctaacagcggagagcaatggcattgaatttcctgataccggtgtttacgcattaagcacg
ttgtataacatagaaatgcaggttgcgcctgcaacaggcgttgcaagctttacatactgg
tcatatggtttaggttttggtggaacatataaaggatacgtaggtggtggctttggccag
tcggcaatgctatcacagccctggtggcagaatgcccttgatacgtacagttcaggtgca
agaatggatcctgttatatccggtagtgcagcatttaacatgtccgtttacacaggcata
tggaacatcttctatggtggcacatcatttgcaacaccaataagcgcaggtgagtgggca
ttaatagaggagcaggcaaagatggcttatggcactgccgcaatgggggatataaaccca
ttactgtatggtgcccataatgcatacgaggcccatgtaactgcattctataataatcca
ttcatagatatggaaaacataggcaggggctttaactacggcccggttaacagctttgac
tggtattacttcaatctatcaataaacgagccctcggatccggtggttccatggtggaca
ttcacaataaatggtcctgagggcaatggctggagctatctccagggtcttgggatgata
aaggtcaatacaatggatcttgaactaataggccagctgccaaccattgatcattcacta
ttaaatgagccgtttaaggtcttaatggttacaccatcaggtttggagccattcacatat
ctccagggaggaaaaacatacacattcaagatattattatcagacggccagcccggaagc
tattacactgttgaggcatactcaggcggtgccgataatggtgtgtacggtggaggaaat
ataaccatgataacaacaaattcaaatggaatgttcaattacacacctgtttacaattat
agttctccatcaatgtccgcctccgagtacggatacttctatgtgacaaccccggcaagc
tcatactggagcttctcgcagttcgcggtaaaagccaaaaatgaaactggcaatttaacc
cttggtgttacaaatgcacttggcgatctatcatacaatgttgctgaggtgccaatgttc
acagatacaatgacaggatattacaattactttggtgccacaggaatcgttgaattgaat
ggcatgcctgtaagcggtgccgtggtacatgaggtatcattgaacaacagtgagttctca
gcagaggattcaggactaccggtatcatcatatgcacctggtgttcagataggcacattt
ttaagtgatggccgtggaatgtttaactactggacggattcagcgcttgccgaattcaat
gggccattatacacacaggttgaggagctttatgcaacctacggcaacctaacaagcaac
aaggtcatagtatacatagagccacaggcaggtaatttctatcctgatctgcacatcgtc
tctggaaaatatcttgttggaaacgttgaattcagcgacatgaagtacgtgaacttcgtt
aacatatcgataggcagtgccccgggagaatacaaaaacgttacatttgcacctgaattc
tatgattacgttccggagttatactttgtaaatggatactatataacggtatataaaaag
gtacctgtaagcggaatattcaatggaataatacctgttaatttaacaataccgtctgga
aaacttgatctcaggatggttgcatccggatacaatgatctatcatttgaatattcattc
tttggctttgtattctcaatccaggatatacagagcccgatagtctggtcagatccgtat
ataatattcaatgctggaacgttaccgcatctcgatatatccggtccatcaggcatggtt
tcaggcaatataacattaaactataatgcatcatctaatgagaatatatcatcatctgta
atagaaatagcatacgccggcggttacaggatactaagaagcgatgcagggctttcagga
tcaataaacataaacacactaaatctgcctgatggttactatatgattaactacattgta
acaacgaacacaggtttaacgtcaaaggcctcggatttaatatacatagataatacagct
gaaaagctccaggcagagcttaacaatataatggcagagtataacagcacggtctctgag
ctaaagcagctccagtcaagattaaccagcgagaaaaatcttaacagcaatttaacatta
aaaatatcggaattaaataataatctgtcgttaatgaagcttgaccttgtatcaatggaa
tcaaggtacaatgcaacatacactgagcttgaatctgcacaggcaaatcttacaaagtat
atagaattaaatgcaagcaatacagtgacaataaacaatcttgaaaatgaaatctcggat
tacaaggctaacataacaatggaaaagaatacaatatcatcacttgaatcaaagatatca
tcaatgcaggccgagatctacaaaatgaggcacccgacagtaacatcgataataaacgat
atcggcggatacacaaccttaataataataggtttgatggccgtggttataggtttaata
atagcatacagaaagaaataa

DBGET integrated database retrieval system