KEGG   Picrophilus torridus: PTO1060Help
Entry
PTO1060           CDS       T00177                                 

Definition
(GenBank) molybdenum cofactor biosynthesis protein B
  KO
K03638  
molybdopterin adenylyltransferase [EC:2.7.7.75]
Organism
pto  Picrophilus torridus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PTO1060
Enzymes [BR:pto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.75  molybdopterin adenylyltransferase
     PTO1060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1072916..1073392)
Genome map
AA seq 158 aa AA seqDB search
MNHHGEKHYNLKFMVTTVSSTRTMENDRSGKSMMNMLLNDYKSVDYGIVHDDEIEILSLL
FKNINDHDVFIFIGGTGVSRRDITSASIRKIADREVKGFGELFRIKSGGIFPYISDASLF
IYRKRIIFTLPGSENAQPLAYEIIKNIIDHLYYEINKE
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaccatggcgagaaacactataatcttaaattcatggtgacaacggtatcaagc
acaagaaccatggaaaatgacagatctggaaaaagcatgatgaacatgcttttaaatgat
tataaaagtgttgattatggtatagttcatgatgatgagatagagatactgtcactgctc
tttaaaaacataaatgatcatgatgtttttatattcattggcggtaccggcgtaagccgt
agggacataacatcggcatcaataagaaaaatagctgacagggaagtaaagggctttggt
gagctcttcaggataaaatccggtggaatatttccttatatatctgatgcatcgttattt
atatacaggaaaaggataatattcacattgcctggatcagaaaatgcacagccgctggca
tatgaaatcataaaaaatattatagatcatctatactatgaaataaataaggaataa

DBGET integrated database retrieval system