KEGG   Picrophilus torridus: PTO1060Help
Entry
PTO1060           CDS       T00177                                 

Definition
(GenBank) molybdenum cofactor biosynthesis protein B
Organism
pto  Picrophilus torridus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1072916..1073392)
Genome map
AA seq 158 aa AA seqDB search
MNHHGEKHYNLKFMVTTVSSTRTMENDRSGKSMMNMLLNDYKSVDYGIVHDDEIEILSLL
FKNINDHDVFIFIGGTGVSRRDITSASIRKIADREVKGFGELFRIKSGGIFPYISDASLF
IYRKRIIFTLPGSENAQPLAYEIIKNIIDHLYYEINKE
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaccatggcgagaaacactataatcttaaattcatggtgacaacggtatcaagc
acaagaaccatggaaaatgacagatctggaaaaagcatgatgaacatgcttttaaatgat
tataaaagtgttgattatggtatagttcatgatgatgagatagagatactgtcactgctc
tttaaaaacataaatgatcatgatgtttttatattcattggcggtaccggcgtaagccgt
agggacataacatcggcatcaataagaaaaatagctgacagggaagtaaagggctttggt
gagctcttcaggataaaatccggtggaatatttccttatatatctgatgcatcgttattt
atatacaggaaaaggataatattcacattgcctggatcagaaaatgcacagccgctggca
tatgaaatcataaaaaatattatagatcatctatactatgaaataaataaggaataa

DBGET integrated database retrieval system