KEGG   Picrophilus torridus: PTO1063Help
Entry
PTO1063           CDS       T00177                                 

Definition
(GenBank) 6-pyruvoyltetrahydropterin 2'-reductase
  KO
K10026  
7-carboxy-7-deazaguanine synthase [EC:4.3.99.3]
Organism
pto  Picrophilus torridus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PTO1063
Enzymes [BR:pto01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.99  Other carbon-nitrogen lyases
    4.3.99.3  7-carboxy-7-deazaguanine synthase
     PTO1063
Transfer RNA biogenesis [BR:pto03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    PTO1063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1075168..1075917)
Genome map
AA seq 249 aa AA seqDB search
MGIRLVDLFYSIQGEGRYAGKPAFFIRFPECNLFCGLEKPLKPGNYDQEYINNLKSVNAG
WVCDTMAQWLSNGFQIDINDIVDYISRLSSGSYNIVFTGGEPLINRSNILKIIDAVNSKN
LKPYIYEIETNGTMEPIEDDSISYNISLKLSGSGMKRSKRINGNIIRKYLLLKNTWWKFV
ISNINDAMEAIEIMDEYGIKRDSVYFMPAAFSRDELVKNSVEVIEMCKEFGVNYSPRLQI
FIYDKYVGV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgggcataaggctggttgacctgttttacagcatacagggtgaggggcgctatgccgga
aagcctgccttttttataagatttcctgaatgcaaccttttttgcgggcttgaaaaacca
ttaaaacctggaaattatgaccaggaatatataaataatttaaaatctgtcaatgctggc
tgggtctgtgacacgatggcccagtggctttcaaatggctttcaaatagatattaacgat
atcgttgattatatatcaagattatcatccggatcttataacatcgtttttacaggtggt
gagccgttgataaatagatcaaacattttaaagataattgatgctgttaacagcaaaaat
ttaaagccctatatctatgaaatagagacaaatggtacaatggaaccgattgaagatgat
tcaatatcatataacatatcattaaaattatccggttccggaatgaagcgatccaaaagg
ataaacggtaatattataagaaaatatttattattaaaaaatacatggtggaaattcgtt
atatctaacataaatgatgccatggaggccattgaaataatggatgaatacggtataaaa
agggatagcgtgtattttatgccagcagccttttccagggatgagctggtaaaaaatagt
gtcgaggtcatagagatgtgcaaggaatttggagtaaactactcaccaaggcttcagatc
tttatctatgataaatacgttggcgtttga

DBGET integrated database retrieval system