KEGG   Picrophilus torridus: PTO1071Help
Entry
PTO1071           CDS       T00177                                 

Definition
(GenBank) methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase
  KO
K01491  
methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
pto  Picrophilus torridus
Pathway
One carbon pool by folate
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:pto00001]
 Metabolism
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    PTO1071
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    PTO1071
Enzymes [BR:pto01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     PTO1071
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     PTO1071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1081861..1082691
Genome map
AA seq 276 aa AA seqDB search
MIIDGVKISETKMERLKNEIEKIKNTGINPKMKIILIGNDYGSVVYSKAKMRRGSKLGID
VDLDRYDSISREDLIKLLKRYSQSDDIHGIMIETPVPGINYYDVVNEIPFYKDVDGMTSY
NLGNLYLKNEFIAPATARAVVDILDYINIKSGNVAIINRSPVVGRPLSMMLLNRDFTVTV
CHSRTVNINEITRSSDIVVVAVGKPNFLDRSYVSDKNIIIDVGINYLNGKTCGDADYENI
KDYVNAITPVPGGVGPVTATDIFENFINGLKYQIKG
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgattatagacggtgttaaaatatccgagacaaagatggaaaggcttaaaaatgagata
gaaaaaataaaaaataccggaataaatccaaaaatgaagattattttaataggaaacgac
tatggaagcgttgtttattcaaaagccaagatgaggcggggctcaaaacttggaatagat
gttgatttagatagatacgattcaatatcccgggaagatcttattaagcttttaaaaaga
tactctcaaagcgatgatatccatggaataatgatagaaacaccagtacctggcataaat
tactatgatgttgtaaatgaaataccattctacaaggacgttgatggcatgacgtcttat
aaccttggaaacctttacctaaaaaatgagttcattgcgcctgcaacagccagggctgtt
gttgacattcttgattatataaatataaaatccggtaacgttgcaataataaacagatct
cctgttgttggcaggcccttatcaatgatgctgttgaacagggacttcacggttacagta
tgccatagcaggacagtgaatataaacgagataacaaggtcatcagatatcgttgttgtt
gccgttggaaaaccaaacttccttgatagatcctatgtgtcagataaaaatataattata
gatgttggcataaactatctcaatggaaagacatgcggtgatgcagattatgaaaatata
aaggattatgttaatgcaataacgccggtgcctggtggcgtcgggccggttacggcaaca
gacatctttgaaaactttattaacggcctaaaataccagataaagggttaa

DBGET integrated database retrieval system