KEGG   Picrophilus torridus: PTO1072Help
Entry
PTO1072           CDS       T00177                                 

Definition
(GenBank) hypothetical membrane associated protein
  KO
K00389  
putative membrane protein
Organism
pto  Picrophilus torridus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1082729..1083058
Genome map
AA seq 109 aa AA seqDB search
MSPSDHLANKRTFLSWVRTGIALMGFGFVIAKFEIFIHILIKSSISKSSIIPGEIMIVIG
IITIIYGLYEYLQNEKDLNENNYNPRNLESIVFSFAIIAMAIVLLLLII
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccatcagatcatcttgcaaacaaaagaacctttttatcatgggtaagaactgga
atagcattaatgggctttggttttgtcatagcaaaattcgagatctttatacatatatta
ataaagagcagcatatcaaaatcaagcataatccccggggagataatgattgtaattgga
ataataacaataatttacggcctttatgaatatttgcagaatgaaaaggatctcaatgaa
aacaattacaatccgagaaatctcgaatccattgtcttttcatttgcaataatagcaatg
gcaatcgtgctgttactattaataatttaa

DBGET integrated database retrieval system