KEGG   Picrophilus torridus: PTO1076Help
Entry
PTO1076           CDS       T00177                                 

Definition
(GenBank) DNA adenine methylase
  KO
K06223  
DNA adenine methylase [EC:2.1.1.72]
Organism
pto  Picrophilus torridus
Pathway
Mismatch repair
Brite
KEGG Orthology (KO) [BR:pto00001]
 Genetic Information Processing
  Replication and repair
   03430 Mismatch repair
    PTO1076
Enzymes [BR:pto01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.72  site-specific DNA-methyltransferase (adenine-specific)
     PTO1076
DNA replication proteins [BR:pto03032]
 Prokaryotic Type
  DNA Replication Termination Factors
   DNA methylation enzymes
    PTO1076
DNA repair and recombination proteins [BR:pto03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    Other MMR factors
     PTO1076
Prokaryotic defense system [BR:pto02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   DNA methyltransferases
    PTO1076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1086197..1086928)
Genome map
AA seq 243 aa AA seqDB search
MNILIKYPGSKGSLLNDIKDVFNRSSCSRLVDVFGGSGIVLLNLDAGEKIYNDINLDLIN
LFKTLKYKYNDLYKMITALKNREVFDYYKYNIDSMGKNDVERAFKTFYLLNTTFGGQGNT
YIKHDKSKFNLVSRIINNMENLRINISSWIIENLDYKYLIEKYDGKNTFFYIDPPYNGKR
WYDFDIDSYKTLNSLISKMQGKYLMNFIRDDGIINIFGNPAFIRKYMSTGSSYRYYYFYT
NVR
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaatatattaataaaatatccaggatcaaagggctctctcttaaatgacataaaagac
gtttttaacaggtcatcatgctcaagattggttgatgtattcggcggctcaggtatagtt
ctgttaaacctcgatgcaggtgaaaagatatacaatgatataaacttggatcttataaat
ctctttaaaacattaaaatacaaatacaatgacctttataaaatgattacagcattaaag
aacagggaggtttttgattattataaatataatatagattccatgggtaaaaatgatgtg
gagagggcatttaaaacattttatttattaaacacaacatttggcggccagggaaatacc
tacataaaacatgataaatcaaaatttaaccttgtttcaaggataataaacaacatggaa
aatttgagaattaatatatcatcatggattattgaaaaccttgattataaatacttaata
gaaaaatatgatggtaaaaacacatttttttacatagatccgccatacaatggtaaaaga
tggtatgattttgatatagattcatacaaaacgttaaatagtttaatatcaaaaatgcag
ggtaaatacctcatgaattttataagggatgatggaattattaatatattcggcaatccg
gcctttataagaaagtatatgagcaccggaagttcatacagatattactatttttataca
aacgtgagatga

DBGET integrated database retrieval system