KEGG   Picrophilus torridus: PTO1078Help
Entry
PTO1078           CDS       T00177                                 

Definition
(GenBank) UDP sulfoquinovose synthase
Organism
pto  Picrophilus torridus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1087590..1088744
Genome map
AA seq 384 aa AA seqDB search
MNVLILGIDGYIGFPLALRFLSMGYNVYGADNFYTRRRVKAVGSDTAIPINTMDIRLKKI
REKTGKSITFFKGNVSNPQFMYDIIKKSSPDVIVHLAEQRSAPYSMIGLRQAIETLDNNI
NSTMNLIYAVKDIKRDAHIIKLGTMGEYGTPNIDIPEGFFNIEYHGRRDYLPFPRSGQSW
YHLSKVHDTNNLMLATKIWGLTVTDVMQGVVYGTRTEELNEYKMTTRFDIDETYGTVLNR
FASQAVLGMPLTVYGAGNQKRGFLSLEDSITCLSLIAEHPEPENYNVINQFDEYYSLNYL
AEKVKEKYEEIYNKDVEISHIDDPRIELDDHYYNPEHKKLYELGFKSRVKLDDEIYNIMN
DLNENRLRLLRLKDSIMPRTFWKS
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttttaattcttggcattgatggttatataggcttcccacttgccctaaggttt
ttatcaatgggatataacgtttacggtgccgataacttttatacaaggaggcgtgtaaag
gctgtcggttctgatacagcgataccaataaatacaatggacattagattaaaaaagata
agggaaaaaactgggaaaagcattacattttttaagggcaacgtttcaaatccacagttc
atgtatgacattataaaaaaatcatccccggatgtcatagtgcatctggcggagcagaga
tccgcgccatattcaatgattggtttaaggcaggcaatagaaacccttgataataatata
aacagcacaatgaatttaatctatgctgtaaaggatataaaaagggatgctcatataata
aagcttggcaccatgggtgagtacggaacaccaaatatagacatacctgaaggctttttt
aatatagagtaccatggaagaagagattatctgccatttccaagatccgggcagtcatgg
tatcacctgagcaaggtgcatgatacaaataatcttatgcttgcaacaaaaatatggggt
ttaacagttacagatgtaatgcagggcgttgtttatggaacaaggacagaggaattgaat
gaatataaaatgacaacaaggtttgacatagatgaaacttatggaacagtattaaacagg
ttcgcctcacaggccgttcttggaatgcctttaacggtatacggcgccggcaatcaaaaa
cgtgggtttttaagccttgaggatagcataacatgcctttcactgatagcagagcatcct
gaacctgaaaattacaatgtaataaaccagtttgatgagtattattcattaaattatctt
gcagaaaaggtcaaggaaaaatacgaggagatttataataaagatgttgaaatatcacat
atcgatgatccaagaatagagctggatgatcattactacaatcctgagcacaaaaaattg
tatgaacttggatttaaaagcagggtaaaacttgatgatgagatatataatattatgaat
gatttgaatgaaaacaggcttagattattaagacttaaagattccatcatgccgaggaca
ttctggaagtcatga

DBGET integrated database retrieval system