KEGG   Picrophilus torridus: PTO1081Help
Entry
PTO1081           CDS       T00177                                 

Definition
(GenBank) hypothetical permease
Organism
pto  Picrophilus torridus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1090181..1091869
Genome map
AA seq 562 aa AA seqDB search
MEQKWVALSNTTIGQLMATINTSIIVVALPPIFRGIHLNPLAHGTFPYLLWSIISYMIVI
SVLLLTIGRLSDMYGRVRLFNLGFLIFTIGSILLYVLPGTGTTAALELIIFRMFQAVGGS
FLMANSFAIITDNFPDDERAFALSINSVASIIGVSVGVVAGGILSIIYWRDVFLISVPVG
IFGTVWSFLKLKETSPRIRHRIDLPGNITFAAGIVLILLGITYGIVPYNAFPMGWENPYV
VISIVLGLALLILFIYVEKHVDNPMFRLDFFKNTGFSIGNFTGFVSAMGMMGLMYMLTIL
FQGVWLPIHGYPYYITPFWAGVYILPMTIAMGIFGIIGGRIANRNNIRLLTSLGLFISSF
SFILIAFLPYDFSYPELAFYLVIFGIGYGLFNAPNISAVMSSVPGDSRGSASGMLNTMRN
LGYTASMGLFFSILIYGLSVYLPGSIKTHLNSIGASSLSLYISKMPATEALFSAFLGINP
VPSILSTVNKSVLSKIQKSTILYISGNTWYPHVLAPAFGSSFSMVFYIAFAITLVSGIIS
IFREPLNYKIKNSLRSKEYVKK
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggagcagaagtgggtggcgctttcgaacacaacgataggccagctcatggcaacaata
aacacaagtataattgttgttgccctgccacctatattccgtggcatacatttaaatcca
ctggcccatggaacctttccataccttttatggtcaattataagttacatgatagttata
tccgtgcttcttttaacaataggacgattaagtgacatgtacggccgcgtccggcttttt
aaccttggctttcttatatttaccattggttcaatactgttatatgtactcccaggaacc
ggcacaacagcggccctcgagctaataatcttcaggatgtttcaggccgttggcggttca
ttcctgatggcaaacagctttgcaattataactgataactttccggatgatgaaagggca
tttgcattatcaataaacagtgttgcatcaatcattggcgtgagcgtcggcgttgttgct
ggaggcatattatcaataatatactggcgtgacgtctttctaataagcgtgcccgtcgga
atctttggaactgtatggtcattcctaaaattaaaggaaacatcgccaaggataaggcat
agaatagatctgccagggaatataacgtttgccgcaggcattgttttaattctcctgggc
attacatacggcatagtcccatacaatgcatttccaatgggctgggagaatccatatgtt
gtaatttcaatagttttgggccttgcacttctaatactttttatatacgtagaaaagcat
gttgacaatccaatgttcagattggacttctttaaaaacactggctttagcataggaaac
ttcacaggttttgtatcagccatgggcatgatgggcctaatgtatatgttaacaatacta
ttccagggtgtctggcttccaatacatggttatccttattatataacaccattctgggca
ggcgtttacatacttccaatgacaattgccatggggatctttggaataattggtggaaga
attgcgaacaggaataacataagacttttaacgtcacttggcctttttatatcatcattt
tcatttatacttatagcctttctaccgtacgatttttcatatccggagctggcattctac
cttgtaatattcggcataggctacggtcttttcaacgcaccaaacatctctgcagtgatg
tcatctgttccaggggattccaggggctcggcatcagggatgcttaacaccatgaggaat
cttggatacactgcaagcatgggtttgttcttttcaattttaatatacggtttatcagta
tatcttccgggaagcataaaaacacatttaaactcaataggtgcatcctcattatcattg
tatatatcaaagatgcccgcgaccgaggctctttttagtgccttccttggtataaatcct
gtgccgtcgatacttagcacggtaaataagtctgtgctgtcaaaaatacaaaaatcaacg
atattatatatttcaggtaacacatggtatccgcatgttcttgcacccgccttcggatca
tcattttcaatggtcttttacatagcatttgcaataaccctggtaagcggaataatctcg
atatttagagagccactgaattataaaataaaaaattcattaagatccaaggaatatgta
aagaaatag

DBGET integrated database retrieval system