KEGG   Picrophilus torridus: PTO1086Help
Entry
PTO1086           CDS       T00177                                 

Definition
(GenBank) N-acyl-L-amino acid amidohydrolase
Organism
pto  Picrophilus torridus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1096432..1097748)
Genome map
AA seq 438 aa AA seqDB search
MEISNDLRDRSLSILNEFLRLESVSAGNSCINETASYLKDLLNDLGINSEIRRSTGNPVV
IGRIDSRSRRIIIYNHYDVQPADPLDEWKTDPFNPRMIGKRLYARGVSDNKGTLIARLIG
IYQALKDKIPVSTTFLYEGEEEIGSPNLENFIKSNKNIINGDSLIMEGGTLMGSRPVISL
GVKGLLYIELSYEIGSSDVHSSMAPVVENPAMEIIKAISALSDGTDITIPGFYKDIRNLT
EDEINIIKEYPVDMENIKRSLGVDNLKKEGSYEYAMSLFTEPTFNIDGFSSGYSGKGSKT
IIPKRAVAKIDMRLVPDQDPNSIYRNILYKLDSVHFKGTVKMLGAEYPVRTSPDGDLSRA
MIESAETVYKIRPVIIINSPGTQPMGLFTRYLKIKDAVSAIGVGDEHSRAHAPNESIDID
NFFLAIKHTYEFIKMYYH
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggaaatttcaaatgatttaagggatagatcactgagcatacttaatgagtttttaaga
cttgaatctgtttcggcaggcaattcttgtataaatgagacggcatcctatttaaaggat
cttttaaatgaccttggaataaattctgaaataagaaggagtactggaaatcccgtcgta
attggcagaatagacagcagatcacgcaggataattatttacaatcattatgatgtgcag
cctgctgatcctctagatgagtggaaaacggacccatttaatccaaggatgattggcaaa
agactttatgccaggggcgtctctgataacaagggaacgcttatagcaagacttattggc
atataccaggcattaaaggataaaataccggtaagtacaacatttctatacgagggtgag
gaggagataggaagcccaaaccttgagaattttataaaaagtaacaagaatattataaat
ggcgattctttaataatggaaggtggcacactgatgggttctagaccggttatatccctt
ggtgttaaaggccttctttatatagaattatcctatgagataggttcaagtgatgtgcat
tcatcaatggcacctgttgttgagaatccggcaatggagattataaaggcaatatcagca
ttatctgatggcacggacataacaatacctggcttttacaaggatataagaaatttaaca
gaggatgagatcaatattataaaggagtaccctgttgatatggaaaatataaagaggagc
cttggtgtggataatttaaaaaaggagggcagctatgagtatgcaatgtcgcttttcaca
gagccaacgttcaatattgatggtttttcctccggttattccggtaaaggctcaaaaaca
ataataccaaaaagggccgtggccaagattgatatgaggcttgtcccagatcaggatcca
aatagtatatacaggaacatattatacaagcttgatagtgtccatttcaagggaactgta
aaaatgcttggtgccgagtatcctgttagaacatcaccggatggtgatttatcaagggcc
atgatagaatcagctgaaaccgtttataaaatcaggcctgttataataataaacagtccg
ggaacacagcccatgggtcttttcacaagatatttaaaaataaaagacgctgttagtgcc
ataggcgtcggtgatgagcattcaagggcacatgcaccaaacgagagcatagatatcgat
aattttttccttgcaataaagcatacgtatgagttcataaaaatgtattatcattaa

DBGET integrated database retrieval system