KEGG   Picrophilus torridus: PTO1087Help
Entry
PTO1087           CDS       T00177                                 

Definition
(GenBank) hypothetical protein
Organism
pto  Picrophilus torridus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1097935..1098297
Genome map
AA seq 120 aa AA seqDB search
MKYESKDNFDSVIKKMHESVTRHGMRIISIINVRENLERFGYNIMNNMIFELSRPDLVYS
LINTDPDMTIILPVRICVYELQHAVYIITQDVKETLENTGLIKIGDEIDKIINEIAMDSI
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacgaatcaaaggataattttgactccgttattaaaaagatgcatgaatcagta
acaaggcacggcatgaggattatatcaataataaatgtgagggaaaatcttgaaagattt
ggttataatataatgaataacatgatatttgaactttcgagaccggatcttgtttattca
ttaataaatactgacccggatatgacaataatactccctgtaagaatatgcgtttatgag
ttgcagcatgctgtttacataataacacaggatgttaaggaaacactcgaaaatacaggc
ttaataaaaattggtgatgaaatagataaaataattaacgaaatagcaatggattctatt
taa

DBGET integrated database retrieval system