KEGG   Picrophilus torridus: PTO1088Help
Entry
PTO1088           CDS       T00177                                 

Definition
(GenBank) sugar binding protein
  KO
K10196  
glucose/arabinose transport system substrate-binding protein
Organism
pto  Picrophilus torridus
Pathway
ABC transporters
Module
Glucose/arabinose transport system
Brite
KEGG Orthology (KO) [BR:pto00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    PTO1088
Transporters [BR:pto02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Glucose/arabinose transporter [MD:M00203] [OT]
    PTO1088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1098388..1099554
Genome map
AA seq 388 aa AA seqDB search
MKAPEEYKGKQRKPWVIPVIVVVIVVIGLGVYFGLVYHPPKKVKTIYFYTWWATDGKVAL
DKEYTAFETSHPGYVVKSELKPGAAGTEAIYAILADIKAGHPPDLFQSLFGPQVLSYIED
APNGAKDFVNMTPIAKSTGLYSNAVTQVLMAGTFNGTMFSLPVDVHRCNELYFNPQVLIK
YNLPFPDNLSELISDSRALESHGIYAWAVPGDDGGYDQTVLWGNIFLSVSQNTTMYDELN
YGTLNLSNPKVLNVLNETNEIFQEFVSDGYPGESSQTWTQAVPKIISGKAGFEAVINSYC
NYAYDFDNTTTYPNTAPYNNTSYIMSHDIKLMSMPFPGTSRYYIILDDSIVVPAGPTQNE
GLTFAEYFSSYSGQLVFTKWKAVTFYKT
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcaccagaggaatataaagggaaacaacgaaagccatgggtaattccagtgatt
gttgttgttatagtcgtcataggtctcggtgtttactttggtttagtctatcatccaccc
aaaaaggtgaagacaatatacttttatacatggtgggcaacggatggcaaggtggctctt
gataaggaatacacagcatttgaaacctcgcacccaggatatgttgttaaaagcgagttg
aaacctggcgctgccggtaccgaggcaatttatgcaattctcgctgatataaaggcaggg
catcctcctgatttattccagtccctgtttggcccgcaggttcttagctatatagaggat
gcaccaaacggtgcaaaggactttgtaaacatgacgccgatagcaaaaagcactggatta
tattcaaacgctgttacacaggttttaatggccggtacatttaatggcacaatgttttca
ttgcccgtggacgttcacagatgcaatgagctttactttaatccacaggtattaataaag
tataatctgccatttccggataatttatctgaattaatatcagacagcagggcacttgaa
agccatggcatatatgcatgggccgttccaggagatgacggtggctatgatcaaacagtt
ctctggggaaatatatttctatccgtaagccagaacacaacaatgtacgatgaattaaat
tacggaacattgaatctgagcaatccaaaggttttaaatgtattaaatgaaactaatgaa
atattccaggaatttgttagtgatggatatcctggagagagctcacagacatggacacag
gcagttccaaagattatctctggaaaggccggttttgaggctgttataaattcgtactgc
aactatgcatacgattttgataacacaacaacatatccaaatacggcaccttacaataat
acatcatacataatgagccatgacataaaattaatgtcaatgccattccctggaacatcg
aggtattatataatactggacgattcaatagttgtgccagcaggaccaacacagaacgag
ggattaacattcgcagaatacttctcatcatactccggacagctggttttcacaaaatgg
aaggcagttacattctataaaacataa

DBGET integrated database retrieval system